SmProt

Specific Information of Small Protein : SPROMMU235601

General Information

Small Protein ID	SPROMMU235601
Organism	Mouse (Mus musculus)
Small Protein Sequence	LANDMKILQGRILAGKLQRTPSADVLKTSESRN*
RNA Sequence	TTGGCAAATGACATGAAGATTCTTCAAGGCAGAATCCTTGCAGGGAAGCTTCAAAGGACTCCATCTGCAGATGTTCTGAAAACCTCTGAGTCTAGAAATTGA
Protein Length	33
Start Codon	TTG
Location	chr1:12728632-12786124:+
Blocks	12728632-12728688,12786078-12786124
Mean PhyloCSF	-5.3487646907
Data Source	Ribosome profiling;
Related Genes	ENSMUSG00000016918; Sulf1; NONMMUG000117;
Mass (Da)	mono. 3623; avg. 3625.2

Ribosome profiling

Ribo-seq ID	Ensembl Gene ID	Ensembl Transcript ID	Symbol	Gene Type	TIS Type	Ribo P value	TIS P value	Start On Trans	Stop On Trans	In-frame Count	Ribo-seq RPKM
GSE106386_alt	ENSMUSG00000016918.15	ENSMUST00000189541.6	Sulf1	Protein_coding	5'UTR	0.003226	None	155	257	20	106.073658
GSE106386_alt	ENSMUSG00000016918.15	ENSMUST00000186051.6	Sulf1	Protein_coding	5'UTR	0.003226	None	192	294	20	106.073658
GSE106386_alt	ENSMUSG00000016918.15	ENSMUST00000088585.9	Sulf1	Protein_coding	5'UTR	0.003226	None	294	396	20	106.073658
GSE106386_alt	ENSMUSG00000016918.15	ENSMUST00000187376.6	Sulf1	Protein_coding	Novel	0.003226	None	364	466	20	106.073658
GSE106386_alt	ENSMUSG00000016918.15	ENSMUST00000177608.7	Sulf1	Protein_coding	5'UTR	0.003226	None	447	549	20	106.073658
GSE106386_alt	ENSMUSG00000016918.15	ENSMUST00000186405.6	Sulf1	Protein_coding	5'UTR	0.003226	None	514	616	20	106.073658

Min Ribo P value	0.003226
Min TIS P value	None

Ribo-seq ID	Cell or Tissue	Phenotype	Ribo-seq Source Details	PMID
GSE106386_alt	ES cell derived neurons E14Tg2A.4	WT	GSM2836997	30349096;

Database information

No results

Literature information

No results

Mass Spectrometry Information

No results

Function and Disease

Functional domain prediction

Analysis	Signature Accession	Signature Description	Start location	Stop location	Score	Status of the match	InterPro accession	InterPro description	GO	Pathways
No results

Related Small Proteins with Different TISs

SmProt ID	Small Protein Length	Start Codon	Strand	Blocks
SPROMMU155665	8	CTG	+	12786097-12786124
SPROMMU40313	15	AGG	+	12728686-12728688, 12786078-12786124
SPROMMU148130	27	ATT	+	12728650-12728688, 12786078-12786124
SPROMMU7570	28	AAG	+	12728647-12728688, 12786078-12786124
SPROMMU84561	29	ATG	+	12728644-12728688, 12786078-12786124
SPROMMU199390	35	GTG	+	12728626-12728688, 12786078-12786124
SPROMMU162258	45	CTG	+	12728596-12728688, 12786078-12786124
SPROMMU146126	59	ATT	+	12692645-12692684, 12728593-12728688, 12786078-12786124
SPROMMU230155	74	TTG	+	12692600-12692684, 12728593-12728688, 12786078-12786124