SmProt

Specific Information of Small Protein : SPROMMU199390

General Information

Small Protein ID	SPROMMU199390
Organism	Mouse (Mus musculus)
Small Protein Sequence	VNLANDMKILQGRILAGKLQRTPSADVLKTSESRN*
RNA Sequence	GTGAATTTGGCAAATGACATGAAGATTCTTCAAGGCAGAATCCTTGCAGGGAAGCTTCAAAGGACTCCATCTGCAGATGTTCTGAAAACCTCTGAGTCTAGAAATTGA
Protein Length	35
Start Codon	GTG
Location	chr1:12728626-12786124:+
Blocks	12728626-12728688,12786078-12786124
Mean PhyloCSF	-5.33788886777
Data Source	Ribosome profiling;
Related Genes	ENSMUSG00000016918; Sulf1; NONMMUG000117;
Mass (Da)	mono. 3836.1; avg. 3838.4

Ribosome profiling

Ribo-seq ID	Ensembl Gene ID	Ensembl Transcript ID	Symbol	Gene Type	TIS Type	Ribo P value	TIS P value	Start On Trans	Stop On Trans	In-frame Count	Ribo-seq RPKM
GSE99585_alt	ENSMUSG00000016918.15	ENSMUST00000189541.6	Sulf1	Protein_coding	5'UTR	0.003083	None	149	257	148	32.9419589
GSE99585_alt	ENSMUSG00000016918.15	ENSMUST00000186051.6	Sulf1	Protein_coding	5'UTR	0.003083	None	186	294	148	32.9419589
GSE99585_alt	ENSMUSG00000016918.15	ENSMUST00000088585.9	Sulf1	Protein_coding	5'UTR	0.003083	None	288	396	148	32.9419589
GSE99585_alt	ENSMUSG00000016918.15	ENSMUST00000187376.6	Sulf1	Protein_coding	Novel	0.003083	None	358	466	148	32.9419589
GSE99585_alt	ENSMUSG00000016918.15	ENSMUST00000177608.7	Sulf1	Protein_coding	5'UTR	0.003083	None	441	549	148	32.9419589
GSE99585_alt	ENSMUSG00000016918.15	ENSMUST00000186405.6	Sulf1	Protein_coding	5'UTR	0.003083	None	508	616	148	32.9419589

Min Ribo P value	0.003083
Min TIS P value	None

Ribo-seq ID	Cell or Tissue	Phenotype	Ribo-seq Source Details	PMID
GSE99585_alt	C57BL/6-Quadriceps muscle	WT	GSM2648077; GSM2648078	28615380;

Database information

No results

Literature information

No results

Mass Spectrometry Information

No results

Function and Disease

Functional domain prediction

Analysis	Signature Accession	Signature Description	Start location	Stop location	Score	Status of the match	InterPro accession	InterPro description	GO	Pathways
No results

Related Small Proteins with Different TISs

SmProt ID	Small Protein Length	Start Codon	Strand	Blocks
SPROMMU155665	8	CTG	+	12786097-12786124
SPROMMU40313	15	AGG	+	12728686-12728688, 12786078-12786124
SPROMMU148130	27	ATT	+	12728650-12728688, 12786078-12786124
SPROMMU7570	28	AAG	+	12728647-12728688, 12786078-12786124
SPROMMU84561	29	ATG	+	12728644-12728688, 12786078-12786124
SPROMMU235601	33	TTG	+	12728632-12728688, 12786078-12786124
SPROMMU162258	45	CTG	+	12728596-12728688, 12786078-12786124
SPROMMU146126	59	ATT	+	12692645-12692684, 12728593-12728688, 12786078-12786124
SPROMMU230155	74	TTG	+	12692600-12692684, 12728593-12728688, 12786078-12786124