SmProt

Specific Information of Small Protein : SPROMMU162258

General Information

Small Protein ID	SPROMMU162258
Organism	Mouse (Mus musculus)
Small Protein Sequence	LRASRHQLEKVNLANDMKILQGRILAGKLQRTPSADVLKTSESRN*
RNA Sequence	CTGAGGGCCAGCCGCCATCAGCTTGAGAAGGTGAATTTGGCAAATGACATGAAGATTCTTCAAGGCAGAATCCTTGCAGGGAAGCTTCAAAGGACTCCATCTGCAGATGTTCTGAAAACCTCTGAGTCTAGAAATTGA
Protein Length	45
Start Codon	CTG
Location	chr1:12728596-12786124:+
Blocks	12728596-12728688,12786078-12786124
Mean PhyloCSF	-5.52015215763
Data Source	Ribosome profiling;
Related Genes	ENSMUSG00000016918; Sulf1; NONMMUG000117;
Mass (Da)	mono. 5054.8; avg. 5057.8

Ribosome profiling

Ribo-seq ID	Ensembl Gene ID	Ensembl Transcript ID	Symbol	Gene Type	TIS Type	Ribo P value	TIS P value	Start On Trans	Stop On Trans	In-frame Count	Ribo-seq RPKM
SRR618774,618775	ENSMUSG00000016918.15	ENSMUST00000186051.6	Sulf1	Protein_coding	5'UTR	0.002005	0.015202	156	294	10	47.6947746
GSE105147_3_alt	ENSMUSG00000016918.15	ENSMUST00000088585.9	Sulf1	Protein_coding	5'UTR	0.013321	None	258	396	6	10.8115316
SRR618774,618775	ENSMUSG00000016918.15	ENSMUST00000088585.9	Sulf1	Protein_coding	5'UTR	0.005012	0.014356	258	396	9	42.9252971
GSE105147_3_alt	ENSMUSG00000016918.15	ENSMUST00000187376.6	Sulf1	Protein_coding	Novel	0.013321	None	328	466	6	10.8115316
SRR618774,618775	ENSMUSG00000016918.15	ENSMUST00000187376.6	Sulf1	Protein_coding	Novel	0.005012	0.014356	328	466	9	42.9252971
SRR618774,618775	ENSMUSG00000016918.15	ENSMUST00000177608.7	Sulf1	Protein_coding	5'UTR	0.002005	0.015202	411	549	10	47.6947746

Min Ribo P value	0.002005
Min TIS P value	None

Ribo-seq ID	Cell or Tissue	Phenotype	Ribo-seq Source Details	PMID
GSE105147_3_alt	C57BL/6-specific expression of MYC(Tg); KRAS(G12D)	Liver tumour	GSM2823265; GSM2823266	30643286;
SRR618774,618775	MEF	WT	SRR618774; SRR618775	22927429;

Database information

No results

Literature information

No results

Mass Spectrometry Information

No results

Function and Disease

Functional domain prediction

Analysis	Signature Accession	Signature Description	Start location	Stop location	Score	Status of the match	InterPro accession	InterPro description	GO	Pathways
No results

Related Small Proteins with Different TISs

SmProt ID	Small Protein Length	Start Codon	Strand	Blocks
SPROMMU155665	8	CTG	+	12786097-12786124
SPROMMU40313	15	AGG	+	12728686-12728688, 12786078-12786124
SPROMMU148130	27	ATT	+	12728650-12728688, 12786078-12786124
SPROMMU7570	28	AAG	+	12728647-12728688, 12786078-12786124
SPROMMU84561	29	ATG	+	12728644-12728688, 12786078-12786124
SPROMMU235601	33	TTG	+	12728632-12728688, 12786078-12786124
SPROMMU199390	35	GTG	+	12728626-12728688, 12786078-12786124
SPROMMU146126	59	ATT	+	12692645-12692684, 12728593-12728688, 12786078-12786124
SPROMMU230155	74	TTG	+	12692600-12692684, 12728593-12728688, 12786078-12786124