SmProt

Specific Information of Small Protein : SPROMMU146126

General Information

Small Protein ID	SPROMMU146126
Organism	Mouse (Mus musculus)
Small Protein Sequence	IHLQQPQETQYFQVLRASRHQLEKVNLANDMKILQGRILAGKLQRTPSADVLKTSESRN*
RNA Sequence	ATTCATTTGCAGCAGCCACAAGAAACGCAGTATTTTCAGGTGCTGAGGGCCAGCCGCCATCAGCTTGAGAAGGTGAATTTGGCAAATGACATGAAGATTCTTCAAGGCAGAATCCTTGCAGGGAAGCTTCAAAGGACTCCATCTGCAGATGTTCTGAAAACCTCTGAGTCTAGAAATTGA
Protein Length	59
Start Codon	ATT
Location	chr1:12692645-12786124:+
Blocks	12692645-12692684,12728593-12728688,12786078-12786124
Mean PhyloCSF	-4.9327666519
Data Source	Ribosome profiling;
Related Genes	ENSMUSG00000016918; Sulf1; NONMMUG000117;
Mass (Da)	mono. 6794.7; avg. 6798.7

Ribosome profiling

Ribo-seq ID	Ensembl Gene ID	Ensembl Transcript ID	Symbol	Gene Type	TIS Type	Ribo P value	TIS P value	Start On Trans	Stop On Trans	In-frame Count	Ribo-seq RPKM
SRR618774,618775	ENSMUSG00000016918.15	ENSMUST00000186051.6	Sulf1	Protein_coding	5'UTR	0.000883	0.00286	114	294	16	58.5055902
SRR618774,618775	ENSMUSG00000016918.15	ENSMUST00000177608.7	Sulf1	Protein_coding	5'UTR	0.000883	0.00286	369	549	16	58.5055902

Min Ribo P value	0.000883
Min TIS P value	0.00286

Ribo-seq ID	Cell or Tissue	Phenotype	Ribo-seq Source Details	PMID
SRR618774,618775	MEF	WT	SRR618774; SRR618775	22927429;

Database information

No results

Literature information

No results

Mass Spectrometry Information

No results

Function and Disease

Functional domain prediction

Analysis	Signature Accession	Signature Description	Start location	Stop location	Score	Status of the match	InterPro accession	InterPro description	GO	Pathways
No results

Related Small Proteins with Different TISs

SmProt ID	Small Protein Length	Start Codon	Strand	Blocks
SPROMMU155665	8	CTG	+	12786097-12786124
SPROMMU40313	15	AGG	+	12728686-12728688, 12786078-12786124
SPROMMU148130	27	ATT	+	12728650-12728688, 12786078-12786124
SPROMMU7570	28	AAG	+	12728647-12728688, 12786078-12786124
SPROMMU84561	29	ATG	+	12728644-12728688, 12786078-12786124
SPROMMU235601	33	TTG	+	12728632-12728688, 12786078-12786124
SPROMMU199390	35	GTG	+	12728626-12728688, 12786078-12786124
SPROMMU162258	45	CTG	+	12728596-12728688, 12786078-12786124
SPROMMU230155	74	TTG	+	12692600-12692684, 12728593-12728688, 12786078-12786124