Specific Information of Small Protein : SPROHSA66042
General Information
| Small Protein ID | SPROHSA66042 |
| Organism | Human (Homo sapiens) |
| Small Protein Sequence | RTPDLLKLHNSHLDVTGLSHVNSSDHVLLYMPSAPSQDSYKRRNDEHP* |
| RNA Sequence | AGGACACCTGACCTTTTGAAGCTTCATAATTCACATCTAGATGTCACCGGTCTTTCCCATGTTAACAGTTCTGACCATGTTTTATTATATATGCCTTCGGCGCCGAGCCAGGACAGCTACAAGAGGAGAAATGATGAACACCCATAG |
| Protein Length | 48 |
| Start Codon | AGG |
| Location | chr6:98926881-98927028:- |
| Blocks | 98926881-98927028 |
| Mean PhyloCSF | -4.08109523326 |
| Data Source | Ribosome profiling; |
| Related Genes | ENSG00000112234; FBXL4; NONHSAG044429; |
| Mass (Da) | mono. 5475.7; avg. 5479 |
Ribosome profiling
| Ribo-seq ID | Ensembl Gene ID | Ensembl Transcript ID | Symbol | Gene Type | TIS Type | Ribo P value | TIS P value | Start On Trans | Stop On Trans | In-frame Count | Ribo-seq RPKM |
|---|
| SRR3208885_alt | ENSG00000112234.9 | ENST00000229971.2 | FBXL4 | Protein_coding | 5'UTR | 0.015893 | None | 351 | 498 | 8 | 9.77747687 |
| GSE58207_alt | ENSG00000112234.9 | ENST00000229971.2 | FBXL4 | Protein_coding | 5'UTR | 8.045E-06 | 0.040878 | 351 | 498 | 24 | 16.8141251 |
| GSE83493_alt | ENSG00000112234.9 | ENST00000229971.2 | FBXL4 | Protein_coding | 5'UTR | 0.005831 | None | 351 | 498 | 23 | 18.7505959 |
| SRR618770,618771,618772,618773_alt | ENSG00000112234.9 | ENST00000229971.2 | FBXL4 | Protein_coding | 5'UTR | 1.197E-05 | 0.025107 | 351 | 498 | 45 | 51.6787960 |
| SRR3208885_alt | ENSG00000112234.9 | ENST00000369244.7 | FBXL4 | Protein_coding | 5'UTR | 0.015893 | None | 409 | 556 | 8 | 9.77747687 |
| GSE58207_alt | ENSG00000112234.9 | ENST00000369244.7 | FBXL4 | Protein_coding | 5'UTR | 8.045E-06 | 0.040878 | 409 | 556 | 24 | 16.8141251 |
| GSE89183_alt | ENSG00000112234.9 | ENST00000369244.7 | FBXL4 | Protein_coding | 5'UTR | 0.013428 | None | 409 | 556 | 6 | 29.7727718 |
| GSE83493_alt | ENSG00000112234.9 | ENST00000369244.7 | FBXL4 | Protein_coding | 5'UTR | 0.005831 | None | 409 | 556 | 23 | 18.7505959 |
| SRR618770,618771,618772,618773_alt | ENSG00000112234.9 | ENST00000369244.7 | FBXL4 | Protein_coding | 5'UTR | 1.197E-05 | 0.025107 | 409 | 556 | 45 | 51.6787960 |
| Min Ribo P value | 8.045E-06 |
| Min TIS P value | None |
| Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
|---|
| GSE58207_alt | HCT116 | Colorectal carcinoma | GSM1403307; GSM1403308 | 25510491; |
| GSE83493_alt | HeLa S3 | Cervical cancer | GSM2204389; GSM2204390; GSM2204391; GSM2204392 | 28460002; |
| GSE89183_alt | CD34+ hematopoietic cells-Erythroid | WT | GSM2360179; GSM2360180 | 29551269; |
| SRR3208885_alt | ES cell-derived neurons TSC2+/+ | WT | GSM2082537 | 27655340; |
| SRR618770,618771,618772,618773_alt | HEK293 | WT | SRR618770; SRR618771; SRR618772; SRR618773 | NA; |
Mass Spectrometry Information
Function and Disease
| Functional domain prediction |  |
| Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
|---|
| No results |
| Disease | Detected |
|---|
| No results |
Related Variants
| Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
|---|
| 6-98926884-A-T | Stop Loss p.*49K | rs34316889 | SRR627627 |
Related Small Proteins with Different TISs
SmProt