Specific Information of Small Protein : SPROHSA23712
General Information
Small Protein ID | SPROHSA23712 |
Organism | Human (Homo sapiens) |
Small Protein Sequence | KLHNSHLDVTGLSHVNSSDHVLLYMPSAPSQDSYKRRNDEHP* |
RNA Sequence | AAGCTTCATAATTCACATCTAGATGTCACCGGTCTTTCCCATGTTAACAGTTCTGACCATGTTTTATTATATATGCCTTCGGCGCCGAGCCAGGACAGCTACAAGAGGAGAAATGATGAACACCCATAG |
Protein Length | 42 |
Start Codon | AAG |
Location | chr6:98926881-98927010:- |
Blocks | 98926881-98927010 |
Mean PhyloCSF | -4.53816278452 |
Data Source | Ribosome profiling; |
Related Genes | ENSG00000112234; FBXL4; NONHSAG044429; |
Mass (Da) | mono. 4780.3; avg. 4783.2 |
Ribosome profiling
Ribo-seq ID | Ensembl Gene ID | Ensembl Transcript ID | Symbol | Gene Type | TIS Type | Ribo P value | TIS P value | Start On Trans | Stop On Trans | In-frame Count | Ribo-seq RPKM |
---|
GSE45833_5_alt | ENSG00000112234.9 | ENST00000229971.2 | FBXL4 | Protein_coding | 5'UTR | 0.012487 | None | 369 | 498 | 9 | 26.8905463 |
SRR5350740_alt | ENSG00000112234.9 | ENST00000229971.2 | FBXL4 | Protein_coding | 5'UTR | 0.01121 | None | 369 | 498 | 4 | 11.3956354 |
GSE45833_5_alt | ENSG00000112234.9 | ENST00000369244.7 | FBXL4 | Protein_coding | 5'UTR | 0.012487 | None | 427 | 556 | 9 | 26.8905463 |
SRR5350740_alt | ENSG00000112234.9 | ENST00000369244.7 | FBXL4 | Protein_coding | 5'UTR | 0.01121 | None | 427 | 556 | 4 | 11.3956354 |
Min Ribo P value | 0.01121 |
Min TIS P value | None |
Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
---|
GSE45833_5_alt | BJ cells | Senescence | GSM1047590 | 23594524; |
SRR5350740_alt | MCF7 | Breast adenocarcinoma | GSM2538884 | 28388414; |
Mass Spectrometry Information
Function and Disease
Functional domain prediction |      |
Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
---|
No results |
Disease | Detected |
---|
No results |
Related Variants
Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
---|
6-98926884-A-T | Stop Loss p.*43K | rs34316889 | SRR627627 |
Related Small Proteins with Different TISs