Specific Information of Small Protein : SPROHSA363766
General Information
| Small Protein ID | SPROHSA363766 |
| Organism | Human (Homo sapiens) |
| Small Protein Sequence | VCFTCGMKKMRTSGQNCLSSEFHAGRKVRRNF* |
| RNA Sequence | GTGTGCTTCACATGTGGCATGAAAAAAATGAGGACCTCTGGTCAAAATTGCCTGAGTTCAGAATTTCATGCTGGAAGGAAAGTTAGACGTAACTTCTAA |
| Protein Length | 32 |
| Start Codon | GTG |
| Location | chr3:101782145-101782244:+ |
| Blocks | 101782145-101782244 |
| Mean PhyloCSF | -8.58230297493 |
| Data Source | Ribosome profiling; |
| Related Genes | ENSG00000144815; NXPE3; |
| Mass (Da) | mono. 3677.8; avg. 3680.3 |
Ribosome profiling
| Ribo-seq ID | Ensembl Gene ID | Ensembl Transcript ID | Symbol | Gene Type | TIS Type | Ribo P value | TIS P value | Start On Trans | Stop On Trans | In-frame Count | Ribo-seq RPKM |
|---|
| SRR618770,618771,618772,618773_alt | ENSG00000144815.16 | ENST00000273347.10 | NXPE3 | Protein_coding | 5'UTR | 0.04952 | 0.025107 | 150 | 249 | 12 | 20.4627151 |
| SRR618770,618771,618772,618773_alt | ENSG00000144815.16 | ENST00000477909.5 | NXPE3 | Protein_coding | 5'UTR | 0.04952 | 0.025107 | 440 | 539 | 12 | 20.4627151 |
| SRR618770,618771,618772,618773_alt | ENSG00000144815.16 | ENST00000491511.6 | NXPE3 | Protein_coding | 5'UTR | 0.04952 | 0.025107 | 495 | 594 | 12 | 20.4627151 |
| Min Ribo P value | 0.04952 |
| Min TIS P value | 0.025107 |
| Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
|---|
| SRR618770,618771,618772,618773_alt | HEK293 | WT | SRR618770; SRR618771; SRR618772; SRR618773 | NA; |
Mass Spectrometry Information
Function and Disease
| Functional domain prediction |  |
| Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
|---|
| No results |
| Disease | Detected |
|---|
| No results |
Related Variants
| Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
|---|
| No results |
Related Small Proteins with Different TISs
SmProt