Specific Information of Small Protein : SPROHSA324758
General Information
| Small Protein ID | SPROHSA324758 |
| Organism | Human (Homo sapiens) |
| Small Protein Sequence | VRQGRVIIATPGAEAMASKPEKRVASSVFITL |
| RNA Sequence | GTGAGACAAGGAAGAGTGATCATTGCCACACCAGGAGCTGAAGCCATGGCCTCAAAGCCTGAGAAGAGGGTGGCATCGTCTGTCTTTATCACCCTG |
| Protein Length | 32 |
| Start Codon | GTG |
| Location | chr1:15764660-15765034:+ |
| Blocks | 15764660-15764685,15764963-15765034 |
| Mean PhyloCSF | 0.809260395666 |
| Data Source | Ribosome profiling; |
| Related Genes | ENSG00000162458; FBLIM1; |
| Mass (Da) | mono. 3381.9; avg. 3384 |
Ribosome profiling
| Ribo-seq ID | Ensembl Gene ID | Ensembl Transcript ID | Symbol | Gene Type | TIS Type | Ribo P value | TIS P value | Start On Trans | Stop On Trans | In-frame Count | Ribo-seq RPKM |
|---|
| GSE45785_2_alt | ENSG00000162458.13 | ENST00000430076.5 | FBLIM1 | Protein_coding | Extended | 0.000235 | None | 410 | 506 | 59 | 363.817220 |
| GSE45785_4_alt | ENSG00000162458.13 | ENST00000430076.5 | FBLIM1 | Protein_coding | Extended | 0.018323 | None | 410 | 506 | 59 | 391.974155 |
| GSE94454_alt | ENSG00000162458.13 | ENST00000430076.5 | FBLIM1 | Protein_coding | Extended | 0.001995 | None | 410 | 506 | 13 | 6.02816599 |
| SRR618770,618771,618772,618773_alt | ENSG00000162458.13 | ENST00000430076.5 | FBLIM1 | Protein_coding | Extended | 0.00148 | 0.000613 | 410 | 506 | 50 | 87.9257293 |
| Min Ribo P value | 0.000235 |
| Min TIS P value | None |
| Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
|---|
| GSE45785_2_alt | BJ cells | Immortalized | GSM1115207 | 23594524; |
| GSE45785_4_alt | BJ cells | Immortalized | GSM1115213 | 23594524; |
| GSE94454_alt | Huh7 | Hepatoma | GSM2476003; GSM2476004; GSM2476005 | 28323820; |
| SRR618770,618771,618772,618773_alt | HEK293 | WT | SRR618770; SRR618771; SRR618772; SRR618773 | NA; |
Mass Spectrometry Information
Function and Disease
| Functional domain prediction |  |
| Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
|---|
| No results |
| Disease | Detected |
|---|
| No results |
Related Variants
| Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
|---|
| No results |
Related Small Proteins with Different TISs
SmProt