Specific Information of Small Protein : SPROHSA36539
General Information
| Small Protein ID | SPROHSA36539 |
| Organism | Human (Homo sapiens) |
| Small Protein Sequence | KVKEVKIDAGVRMRMNLKKENWYSKRMVRSMLR* |
| RNA Sequence | AAGGTAAAGGAGGTAAAAATAGACGCAGGGGTAAGAATGAGAATGAATCTGAAAAAAGAGAACTGGTATTCAAAGAGGATGGTCAGGAGTATGCTCAGGTAA |
| Protein Length | 33 |
| Start Codon | AAG |
| Location | chr1:16685940-16686042:- |
| Blocks | 16685940-16686042 |
| Mean PhyloCSF | 0 |
| Data Source | Ribosome profiling; |
| Related Genes | ENSG00000280114; AL021920.2; ENSG00000236698; EIF1AXP1; NONHSAG000487; |
| Mass (Da) | mono. 4079.2; avg. 4081.9 |
Ribosome profiling
| Ribo-seq ID | Ensembl Gene ID | Ensembl Transcript ID | Symbol | Gene Type | TIS Type | Ribo P value | TIS P value | Start On Trans | Stop On Trans | In-frame Count | Ribo-seq RPKM |
|---|
| GSE45833_2_alt | ENSG00000236698.1 | ENST00000419267.1 | EIF1AXP1 | Processed_pseudogene | Novel | 0.000946 | None | 13 | 115 | 67 | 90.2008308 |
| GSE45833_4_alt | ENSG00000236698.1 | ENST00000419267.1 | EIF1AXP1 | Processed_pseudogene | Novel | 0.036392 | None | 13 | 115 | 52 | 110.148115 |
| GSE45833_3_alt | ENSG00000236698.1 | ENST00000419267.1 | EIF1AXP1 | Processed_pseudogene | Novel | 1.22E-05 | None | 13 | 115 | 68 | 236.998274 |
| Min Ribo P value | 1.22E-05 |
| Min TIS P value | None |
| Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
|---|
| GSE45833_2_alt | BJ cells | Quiescence | GSM1047586; GSM1047587 | 23594524; |
| GSE45833_3_alt | BJ cells | Pre-senescence | GSM1047588 | 23594524; |
| GSE45833_4_alt | BJ cells | Proliferation | GSM1047589 | 23594524; |
Mass Spectrometry Information
Function and Disease
| Functional domain prediction |       |
| Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
|---|
| No results |
| Disease | Detected |
|---|
| No results |
Related Variants
| Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
|---|
| 1-16685957-C-T | Non-Synonymous p.R29K | . | SRR5239050; SRR5239051; SRR5239052; SRR5239056 |
| 1-16685960-A-T | Non-Synonymous p.V28D | . | SRR5239050; SRR5239051; SRR5239052; SRR5239056 |
| 1-16685973-A-T | Non-Synonymous p.S24T | . | SRR8310200 |
| 1-16686013-C-T | Synonymous p.G10G | . | SRR7182548 |
| 1-16686014-C-A | Non-Synonymous p.G10V | . | SRR618770 |
| 1-16686020-T-C | Non-Synonymous p.D8G | . | SRR627625 |
| 1-16686023-A-G | Non-Synonymous p.I7T | . | SRR2818787; SRR2818791; SRR3208921; SRR3575897; SRR3575898; SRR4045276; SRR5047771; SRR5227295; SRR5227296; SRR5350740; SRR5350744; SRR5350745; SRR5382423; SRR5990809; SRR5990810; SRR5990811; SRR6053333; SRR7207252; SRR8310199; SRR7182546; SRR7182548; SRR6181539; SRR6181540; SRR6181541; SRR5943474; SRR3680966; SRR3680969; SRR1333393; SRR1333394; SRR627620; SRR627621; SRR627622; SRR627625; SRR627626; SRR1795425; SRR1795426; SRR1795427; SRR1795428; SRR964946; SRR618770; SRR618772; SRR618771; SRR618773 |
Related Small Proteins with Different TISs