Specific Information of Small Protein : SPROHSA230052
General Information
| Small Protein ID | SPROHSA230052 |
| Organism | Human (Homo sapiens) |
| Small Protein Sequence | IIFPACCWIWGNFLFVFYDLYLTERNPLKTSA* |
| RNA Sequence | ATTATTTTTCCTGCCTGTTGTTGGATTTGGGGAAATTTTTTGTTTGTTTTTTATGATTTGTATTTGACTGAGAGAAACCCACTGAAGACGTCTGCGTGA |
| Protein Length | 32 |
| Start Codon | ATT |
| Location | chr12:46372525-46372624:- |
| Blocks | 46372525-46372624 |
| Mean PhyloCSF | -7.55434346681 |
| Data Source | Ribosome profiling; |
| Related Genes | ENSG00000134294; SLC38A2; ENSG00000258096; AC025031.2; NONHSAG010985;NONHSAG010986; |
| Mass (Da) | mono. 3839.9; avg. 3842.5 |
Ribosome profiling
| Ribo-seq ID | Ensembl Gene ID | Ensembl Transcript ID | Symbol | Gene Type | TIS Type | Ribo P value | TIS P value | Start On Trans | Stop On Trans | In-frame Count | Ribo-seq RPKM |
|---|
| GSE45833_2_alt | ENSG00000134294.14 | ENST00000549258.5 | SLC38A2 | Protein_coding | 5'UTR | 0.008305 | None | 147 | 246 | 158 | 219.158237 |
| GSE45833_4_alt | ENSG00000134294.14 | ENST00000549258.5 | SLC38A2 | Protein_coding | 5'UTR | 4.854E-05 | None | 147 | 246 | 191 | 416.842578 |
| SRR618770,618771,618772,618773_alt | ENSG00000134294.14 | ENST00000549258.5 | SLC38A2 | Protein_coding | 5'UTR | 7.959E-07 | 3.022E-17 | 147 | 246 | 301 | 513.273106 |
| SRR964946_alt | ENSG00000134294.14 | ENST00000549258.5 | SLC38A2 | Protein_coding | 5'UTR | 0.002137 | 0.019474 | 147 | 246 | NA | NA |
| GSE45833_2_alt | ENSG00000134294.14 | ENST00000256689.10 | SLC38A2 | Protein_coding | 5'UTR | 0.008305 | None | 149 | 248 | 158 | 219.158237 |
| GSE45833_4_alt | ENSG00000134294.14 | ENST00000256689.10 | SLC38A2 | Protein_coding | 5'UTR | 4.854E-05 | None | 149 | 248 | 191 | 416.842578 |
| GSE45833_2_alt | ENSG00000134294.14 | ENST00000553252.1 | SLC38A2 | Protein_coding | Novel | 0.008305 | None | 149 | 248 | 158 | 219.158237 |
| GSE45833_4_alt | ENSG00000134294.14 | ENST00000553252.1 | SLC38A2 | Protein_coding | Novel | 4.854E-05 | None | 149 | 248 | 191 | 416.842578 |
| SRR618770,618771,618772,618773_alt | ENSG00000134294.14 | ENST00000256689.10 | SLC38A2 | Protein_coding | 5'UTR | 7.959E-07 | 3.022E-17 | 149 | 248 | 301 | 513.273106 |
| SRR618770,618771,618772,618773_alt | ENSG00000134294.14 | ENST00000553252.1 | SLC38A2 | Protein_coding | Novel | 7.959E-07 | 7.082E-07 | 149 | 248 | 301 | 513.273106 |
| SRR964946_alt | ENSG00000134294.14 | ENST00000256689.10 | SLC38A2 | Protein_coding | 5'UTR | 0.002137 | 0.019474 | 149 | 248 | NA | NA |
| Min Ribo P value | 7.959E-07 |
| Min TIS P value | 3.022E-17 |
| Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
|---|
| GSE45833_2_alt | BJ cells | Quiescence | GSM1047586; GSM1047587 | 23594524; |
| GSE45833_4_alt | BJ cells | Proliferation | GSM1047589 | 23594524; |
| SRR618770,618771,618772,618773_alt | HEK293 | WT | SRR618770; SRR618771; SRR618772; SRR618773 | NA; |
| SRR964946_alt | HEK293 | WT | SRR964946 | 22927429; |
Mass Spectrometry Information
Function and Disease
| Functional domain prediction |  |
| Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
|---|
| No results |
| Disease | Detected |
|---|
| No results |
Related Variants
| Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
|---|
| No results |
Related Small Proteins with Different TISs
SmProt