SmProt

Specific Information of Small Protein : SPROHSA372006

General Information

Small Protein ID	SPROHSA372006
Organism	Human (Homo sapiens)
Small Protein Sequence	LILGQPPVKRRRSVMPLEDWMNILQEPDEGGHAG*
RNA Sequence	TTGATCCTGGGCCAGCCACCTGTCAAGAGGAGGCGGAGCGTCATGCCTCTGGAAGACTGGATGAATATTCTCCAGGAGCCTGACGAAGGCGGCCATGCTGGATAA
Protein Length	34
Start Codon	TTG
Location	chr9:120843349-120847308:+
Blocks	120843349-120843439,120847293-120847308
Mean PhyloCSF	-6.93282859325
Data Source	Ribosome profiling;
Related Genes	ENSG00000226752; CUTALP; NONHSAG053338;
Mass (Da)	mono. 3838; avg. 3840.4

Ribosome profiling

Ribo-seq ID	Ensembl Gene ID	Ensembl Transcript ID	Symbol	Gene Type	TIS Type	Ribo P value	TIS P value	Start On Trans	Stop On Trans	In-frame Count	Ribo-seq RPKM
GSE103308_alt	ENSG00000226752.9	ENST00000640391.1	CUTALP	Transcribed_unitary_pseudogene	Novel	0.012775	None	354	459	6	5.08293216

Min Ribo P value	0.012775
Min TIS P value	None

Ribo-seq ID	Cell or Tissue	Phenotype	Ribo-seq Source Details	PMID
GSE103308_alt	RD-muscle	WT	GSM2760247	29696588;

Database information

No results

Literature information

No results

Mass Spectrometry Information

No results

Function and Disease

Functional domain prediction

Analysis	Signature Accession	Signature Description	Start location	Stop location	Score	Status of the match	InterPro accession	InterPro description	GO	Pathways
No results

Disease	Detected
No results

Related Variants

Variant ID	Consequence to sORF	rsID	Ribo-seq ID
No results

Related Small Proteins with Different TISs

SmProt ID	Small Protein Length	Start Codon	Strand	Blocks
SPROHSA170051	20	ATG	+	120843391-120843439, 120847293-120847308
SPROHSA80490	24	AGG	+	120843379-120843439, 120847293-120847308
SPROHSA301125	32	CTG	+	120843355-120843439, 120847293-120847308
SPROHSA55337	51	ACG	+	120843298-120843439, 120847293-120847308
SPROHSA187238	57	ATG	+	120843280-120843439, 120847293-120847308