Specific Information of Small Protein : SPROHSA301125
General Information
| Small Protein ID | SPROHSA301125 |
| Organism | Human (Homo sapiens) |
| Small Protein Sequence | LGQPPVKRRRSVMPLEDWMNILQEPDEGGHAG* |
| RNA Sequence | CTGGGCCAGCCACCTGTCAAGAGGAGGCGGAGCGTCATGCCTCTGGAAGACTGGATGAATATTCTCCAGGAGCCTGACGAAGGCGGCCATGCTGGATAA |
| Protein Length | 32 |
| Start Codon | CTG |
| Location | chr9:120843355-120847308:+ |
| Blocks | 120843355-120843439,120847293-120847308 |
| Mean PhyloCSF | -6.96069698984 |
| Data Source | Ribosome profiling; |
| Related Genes | ENSG00000226752; CUTALP; NONHSAG053338; |
| Mass (Da) | mono. 3611.8; avg. 3614.1 |
Ribosome profiling
| Min Ribo P value | 0.025974 |
| Min TIS P value | None |
| Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
|---|
| SRR5047770_alt | iPSC-differentiated dopamine neurons | Parkinson Disease | GSM2402496; GSM2402497; GSM2402498 | NA; |
Mass Spectrometry Information
Function and Disease
| Functional domain prediction |       |
| Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
|---|
| No results |
| Disease | Detected |
|---|
| No results |
Related Variants
| Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
|---|
| No results |
Related Small Proteins with Different TISs
| SmProt ID | Small Protein Length | Start Codon | Strand | Blocks |
|---|
| SPROHSA170051 | 20 | ATG | + | 120843391-120843439, 120847293-120847308 |
| SPROHSA80490 | 24 | AGG | + | 120843379-120843439, 120847293-120847308 |
| SPROHSA372006 | 34 | TTG | + | 120843349-120843439, 120847293-120847308 |
| SPROHSA55337 | 51 | ACG | + | 120843298-120843439, 120847293-120847308 |
| SPROHSA187238 | 57 | ATG | + | 120843280-120843439, 120847293-120847308 |