Specific Information of Small Protein : SPROHSA136204
General Information
| Small Protein ID | SPROHSA136204 | ||
| Organism | human (Homo sapiens) | ||
| Small Protein Sequence | MKKLPSPYITNLCCAPTRTCFKFPWQFTTPILYQARL | ||
| RNA Sequence | ATGAAAAAACTACCATCCCCGTATATAACTAATTTGTGCTGTGCACCAACAAGAACCTGCTTTAAATTTCCATGGCAATTTACAACCCCCATACTGTACCAGGCAAGGTTA | ||
| Protein Length | 37 | ||
| Start Codon | ATG | ||
| Location | chr14:58285586-58285697:- | ||
| Blocks | 58285586-58285697 | ||
| Mean PhyloCSF | 0 | ||
| Data Source | Ribosome profiling; | ||
| Related Genes | ENSG00000139971; ARMH4; ENSG00000257621; PSMA3-AS1; NONHSAG015097;NONHSAG015108; | ||
Ribosome profiling
| RiboID | GeneID | TransID | Symbol | GeneType | TISType | RiboPvalue | TISPvalue | StartOnTrans | StopOnTrans |
|---|---|---|---|---|---|---|---|---|---|
| SRR4045276 | ENSG00000257621.8 | ENST00000557412.1 | PSMA3-AS1 | lncRNA | Novel | 0.011028 | None | 443 | 554 |
| GSE105082 | ENSG00000257621.8 | ENST00000557412.1 | PSMA3-AS1 | lncRNA | Novel | 0.001027 | None | 443 | 554 |
| GSE83493 | ENSG00000257621.8 | ENST00000557412.1 | PSMA3-AS1 | lncRNA | Novel | 0.011028 | None | 443 | 554 |
| GSE83493_alt | ENSG00000257621.8 | ENST00000557412.1 | PSMA3-AS1 | lncRNA | Novel | 0.011028 | None | 443 | 554 |
| SRR618770,618771,618772,618773_alt | ENSG00000257621.8 | ENST00000557412.1 | PSMA3-AS1 | lncRNA | Novel | 0.030129 | 0.002859 | 443 | 554 |
| Min Ribo Pvalue | 0.001027 |
| Min TIS Pvalue | None |
| RiboID | CellORTissue | Phenotype | RiboSource | PMID |
|---|---|---|---|---|
| GSE105082 | HELA | cervical cancer | GSM2817679;GSM2817680 | 30591072; |
| GSE83493 | HeLa S3 | cervical cancer | GSM2204389;GSM2204390;GSM2204391;GSM2204392 | 28460002; |
| GSE83493_alt | HeLa S3 | cervical cancer | GSM2204389;GSM2204390;GSM2204391;GSM2204392 | 28460002; |
| SRR4045276 | Meg01 cells | WT | GSM2285909 | 27681415; |
| SRR618770,618771,618772,618773_alt | HEK293 | WT | SRR618770;SRR618771;SRR618772;SRR618773 | NA; |
Database information
| No results |
Literature information
| No results |
Mass Spectrometry Information
| No results |
Function and Disease
| Functional domain prediction |  |
| Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
|---|---|---|---|---|---|---|---|---|---|---|
| No results | ||||||||||
| Disease | Detected | |
|---|---|---|
| No results | ||
Related Variants
| VarID | Consequence To sORF | rsID | RiboID |
|---|---|---|---|
| No results | |||
Related Small Proteins with Different TISs
| ID | Small Protein Length | Start Codon | Strand | Blocks |
|---|---|---|---|---|
| SPROHSA252262 | 39 | CTG | - | 58285586-58285703 |
| SPROHSA17514 | 45 | AAG | - | 58285586-58285721 |
| SPROHSA246484 | 48 | ATT | - | 58285586-58285730 |
| SPROHSA230009 | 49 | ATT | - | 58285586-58285733 |
References
| PMID | 27681415 |
| Title | Dynamic Regulation of a Ribosome Rescue Pathway in Erythroid Cells and Platelets |
| Journal | Cell Rep.2016 Sep 27;17(1):1-10.doi: 10.1016/j.celrep.2016.08.088. |
| Authors | Eric W Mills,Jamie Wangen,Rachel Green,Nicholas T Ingolia |
| PMID | 28460002 |
| Title | Proteomic analysis of polyribosomes identifies splicing factors as potential regulators of translation during mitosis |
| Journal | Nucleic Acids Res.2017 Jun 2;45(10):5945-5957.doi: 10.1093/nar/gkx326. |
| Authors | Ranen Aviner,Sarah Hofmann,Tamar Elman,Anjana Shenoy,Tamar Geiger,Ran Elkon,Marcelo Ehrlich,Orna Elroy-Stein |
| PMID | 30591072 |
| Title | RNA G-quadruplexes at upstream open reading frames cause DHX36- and DHX9-dependent translation of human mRNAs |
| Journal | Genome Biol.2018 Dec 27;19(1):229.doi: 10.1186/s13059-018-1602-2. |
| Authors | Pierre Murat,Giovanni Marsico,Barbara Herdy,Avazeh T Ghanbarian,Guillem Portella,Shankar Balasubramanian |