Small Protein ID | SPROHSA136204 | ||
Organism | human (Homo sapiens) | ||
Small Protein Sequence | MKKLPSPYITNLCCAPTRTCFKFPWQFTTPILYQARL | ||
RNA Sequence | ATGAAAAAACTACCATCCCCGTATATAACTAATTTGTGCTGTGCACCAACAAGAACCTGCTTTAAATTTCCATGGCAATTTACAACCCCCATACTGTACCAGGCAAGGTTA | ||
Protein Length | 37 | ||
Start Codon | ATG | ||
Location | chr14:58285586-58285697:- | ||
Blocks | 58285586-58285697 | ||
Mean PhyloCSF | 0 | ||
Data Source | Ribosome profiling; | ||
Related Genes | ENSG00000139971; ARMH4; ENSG00000257621; PSMA3-AS1; NONHSAG015097;NONHSAG015108; |
RiboID | GeneID | TransID | Symbol | GeneType | TISType | RiboPvalue | TISPvalue | StartOnTrans | StopOnTrans |
---|---|---|---|---|---|---|---|---|---|
SRR4045276 | ENSG00000257621.8 | ENST00000557412.1 | PSMA3-AS1 | lncRNA | Novel | 0.011028 | None | 443 | 554 |
GSE105082 | ENSG00000257621.8 | ENST00000557412.1 | PSMA3-AS1 | lncRNA | Novel | 0.001027 | None | 443 | 554 |
GSE83493 | ENSG00000257621.8 | ENST00000557412.1 | PSMA3-AS1 | lncRNA | Novel | 0.011028 | None | 443 | 554 |
GSE83493_alt | ENSG00000257621.8 | ENST00000557412.1 | PSMA3-AS1 | lncRNA | Novel | 0.011028 | None | 443 | 554 |
SRR618770,618771,618772,618773_alt | ENSG00000257621.8 | ENST00000557412.1 | PSMA3-AS1 | lncRNA | Novel | 0.030129 | 0.002859 | 443 | 554 |
Min Ribo Pvalue | 0.001027 |
Min TIS Pvalue | None |
RiboID | CellORTissue | Phenotype | RiboSource | PMID |
---|---|---|---|---|
GSE105082 | HELA | cervical cancer | GSM2817679;GSM2817680 | 30591072; |
GSE83493 | HeLa S3 | cervical cancer | GSM2204389;GSM2204390;GSM2204391;GSM2204392 | 28460002; |
GSE83493_alt | HeLa S3 | cervical cancer | GSM2204389;GSM2204390;GSM2204391;GSM2204392 | 28460002; |
SRR4045276 | Meg01 cells | WT | GSM2285909 | 27681415; |
SRR618770,618771,618772,618773_alt | HEK293 | WT | SRR618770;SRR618771;SRR618772;SRR618773 | NA; |
No results |
No results |
No results |
Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
---|---|---|---|---|---|---|---|---|---|---|
No results |
Disease | Detected | |
---|---|---|
No results |
VarID | Consequence To sORF | rsID | RiboID |
---|---|---|---|
No results |
ID | Small Protein Length | Start Codon | Strand | Blocks |
---|---|---|---|---|
SPROHSA252262 | 39 | CTG | - | 58285586-58285703 |
SPROHSA17514 | 45 | AAG | - | 58285586-58285721 |
SPROHSA246484 | 48 | ATT | - | 58285586-58285730 |
SPROHSA230009 | 49 | ATT | - | 58285586-58285733 |
PMID | 27681415 |
Title | Dynamic Regulation of a Ribosome Rescue Pathway in Erythroid Cells and Platelets |
Journal | Cell Rep.2016 Sep 27;17(1):1-10.doi: 10.1016/j.celrep.2016.08.088. |
Authors | Eric W Mills,Jamie Wangen,Rachel Green,Nicholas T Ingolia |
PMID | 28460002 |
Title | Proteomic analysis of polyribosomes identifies splicing factors as potential regulators of translation during mitosis |
Journal | Nucleic Acids Res.2017 Jun 2;45(10):5945-5957.doi: 10.1093/nar/gkx326. |
Authors | Ranen Aviner,Sarah Hofmann,Tamar Elman,Anjana Shenoy,Tamar Geiger,Ran Elkon,Marcelo Ehrlich,Orna Elroy-Stein |
PMID | 30591072 |
Title | RNA G-quadruplexes at upstream open reading frames cause DHX36- and DHX9-dependent translation of human mRNAs |
Journal | Genome Biol.2018 Dec 27;19(1):229.doi: 10.1186/s13059-018-1602-2. |
Authors | Pierre Murat,Giovanni Marsico,Barbara Herdy,Avazeh T Ghanbarian,Guillem Portella,Shankar Balasubramanian |