Specific Information of Small Protein : SPROHSA136203
General Information
Small Protein ID | SPROHSA136203 |
Organism | Human (Homo sapiens) |
Small Protein Sequence | MKKLPSPYITNLCCAPTRTCFKFPWQFTTPILYQARYQHQDDLW* |
RNA Sequence | ATGAAAAAACTACCATCCCCGTATATAACTAATTTGTGCTGTGCACCAACAAGAACCTGCTTTAAATTTCCATGGCAATTTACAACCCCCATACTGTACCAGGCAAGGTACCAGCATCAAGATGATTTATGGTAA |
Protein Length | 44 |
Start Codon | ATG |
Location | chr14:58273982-58285697:- |
Blocks | 58273982-58274010,58285590-58285697 |
Mean PhyloCSF | -2.18614075272 |
Data Source | Ribosome profiling; |
Related Genes | ENSG00000139971; ARMH4; ENSG00000257621; PSMA3-AS1; ENSG00000180189; HMGB1P14; NONHSAG015097;NONHSAG015108; |
Mass (Da) | mono. 5348.6; avg. 5352.2 |
Ribosome profiling
Min Ribo P value | 0.034466 |
Min TIS P value | None |
Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
---|
SRR4045276 | Meg01 cells | WT | GSM2285909 | 27681415; |
Mass Spectrometry Information
Function and Disease
Functional domain prediction |      |
Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
---|
No results |
Disease | Detected |
---|
No results |
Related Variants
Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
---|
No results |
Related Small Proteins with Different TISs
SmProt ID | Small Protein Length | Start Codon | Strand | Blocks |
---|
SPROHSA17513 | 52 | AAG | - | 58273982-58274010, 58285590-58285721 |
SPROHSA370546 | 74 | TTG | - | 58273982-58274010, 58285590-58285756, 58291634-58291665 |
SPROHSA200501 | 83 | ATG | - | 58273982-58274010, 58285590-58285756, 58291634-58291692 |