SmProt

Specific Information of Small Protein : SPROMMU96746

General Information

Small Protein ID	SPROMMU96746
Organism	Mouse (Mus musculus)
Small Protein Sequence	MMNADMDAVDAENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK*
RNA Sequence	ATGATGAATGCTGACATGGACGCAGTTGATGCTGAAAATCAGGTGGAACTGGAAGAAAAGACTCGACTTATTAATCAGGTGTTGGAACTCCAACACACACTTGAAGATCTTTCTGCAAGAGTAGATGCAGTTAAGGAAGAAAATCTGAAGCTAAAGTCGGAAAATCAAGTTCTCGGACAATATATAGAAAACCTCATGTCTGCTTCTAGTGTTTTTCAAACAACTGATACAAAAAGCAAAAGGAAGTAA
Protein Length	82
Start Codon	ATG
Location	chr8:83435897-83438006:-
Blocks	83435897-83436040,83437552-83437636,83437984-83438006
Mean PhyloCSF	-6.60351006573
Data Source	Ribosome profiling; Database; Literature;
Related Genes	ENSMUSG00000063253; Scoc;
Mass (Da)	mono. 9348.7; avg. 9354.4

Ribosome profiling

Ribo-seq ID	Ensembl Gene ID	Ensembl Transcript ID	Symbol	Gene Type	TIS Type	Ribo P value	TIS P value	Start On Trans	Stop On Trans	In-frame Count	Ribo-seq RPKM
GSE84112_2	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	8.838E-05	None	121	370	41	14.8950305
GSE99787_4	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	0.000121	None	121	370	13	12.0796574
GSE99787_4_alt	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	0.000121	None	121	370	13	12.0796574
GSE105147_2	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	0.018474	None	121	370	12	5.14897251
GSE102659_1	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	0.005292	None	121	370	12	10.1075442
GSE102659_2	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	0.003065	None	121	370	11	9.20660124
GSE50983	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	1.857E-08	None	121	370	56	36.0801514
GSE50983_alt	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	1.857E-08	None	121	370	56	36.0801514
GSE59793	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	0.00379	None	121	370	6	9.44982607
GSE59793_alt	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	0.00379	None	121	370	6	9.44982607
GSE81283_1	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	2.215E-07	None	121	370	403	63.7723958
GSE83823	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	0.00059	None	121	370	19	49.6962230
GSE89184_1	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	1.899E-11	None	121	370	56	47.3103021
GSE89184_1_alt	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	1.899E-11	None	121	370	56	47.3103021
GSE111891	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	5.515E-14	None	121	370	495	98.8667697
GSE111891_alt	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	5.515E-14	None	121	370	495	98.8667697
GSE60930	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	0.010514	None	121	370	12	46.2021070
GSE60930_alt	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	0.010514	None	121	370	12	46.2021070
SRR618774,618775	ENSMUSG00000063253.11	ENSMUST00000212905.1	Scoc	Protein_coding	Annotated	2.389E-05	0.000255	121	370	23	60.7964717
GSE84112_2	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	8.838E-05	None	134	383	41	14.8950305
GSE99787_4	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	0.000121	None	134	383	13	12.0796574
GSE99787_4_alt	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	0.000121	None	134	383	13	12.0796574
GSE105147_2	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	0.018474	None	134	383	12	5.14897251
GSE102659_1	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	0.005292	None	134	383	12	10.1075442
GSE102659_2	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	0.003065	None	134	383	11	9.20660124
GSE50983	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	1.857E-08	None	134	383	56	36.0801514
GSE50983_alt	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	1.857E-08	None	134	383	56	36.0801514
GSE59793	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	0.00379	None	134	383	6	9.44982607
GSE59793_alt	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	0.00379	None	134	383	6	9.44982607
GSE81283_1	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	2.215E-07	None	134	383	403	63.7723958
GSE83823	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	0.00059	None	134	383	19	49.6962230
GSE89184_1	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	1.899E-11	None	134	383	56	47.3103021
GSE89184_1_alt	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	1.899E-11	None	134	383	56	47.3103021
GSE111891	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	5.515E-14	None	134	383	495	98.8667697
GSE111891_alt	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	5.515E-14	None	134	383	495	98.8667697
GSE60930	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	0.010514	None	134	383	12	46.2021070
GSE60930_alt	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	0.010514	None	134	383	12	46.2021070
SRR618774,618775	ENSMUSG00000063253.11	ENSMUST00000212031.1	Scoc	Protein_coding	Annotated	2.389E-05	0.010411	134	383	23	60.7964717

Min Ribo P value	5.515E-14
Min TIS P value	None

Ribo-seq ID	Cell or Tissue	Phenotype	Ribo-seq Source Details	PMID
GSE102659_1	C57BL/6-liver	WT-normal	GSM2742565	29429926;
GSE102659_2	C57BL/6-liver	WT-fasting	GSM2742567	29429926;
GSE105147_2	C57BL/6-specific expression of LSL-KRAS(G12D)	Liver tumour	GSM2823261; GSM2823262	30643286;
GSE111891	B16 melanoma cell line	Melanoma	GSM3043640; GSM3043641; GSM3043642	29925953;
GSE111891_alt	B16 melanoma cell line	Melanoma	GSM3043640; GSM3043641; GSM3043642	29925953;
GSE50983	129SvJae-testis	WT	GSM1234248; GSM1234252	25063675;
GSE50983_alt	129SvJae-testis	WT	GSM1234248; GSM1234252	25063675;
GSE59793	C57BL/6J-BMDCs	WT	GSM1554684; GSM1554685	25745177;
GSE59793_alt	C57BL/6J-BMDCs	WT	GSM1554684; GSM1554685	25745177;
GSE60930	macrophages RAW 264	WT	GSM2054396; GSM2054397	24974721;
GSE60930_alt	macrophages RAW 264	WT	GSM2054396; GSM2054397	24974721;
GSE81283_1	C57BL/6JRj-kidney	WT	GSM2149102; GSM2149103	28622766;
GSE83823	C57BL/6-fetal liver-Erythroid progenitors	WT	GSM2219142	27899360;
GSE84112_2	ROSA26mT/mG 5-8 weeks liver	WT	GSM2227371; GSM2227372; GSM2227373	NA;
GSE89184_1	C57Bl/6J-Bone Marrow Macrophages	WT	GSM2360198	28383283;
GSE89184_1_alt	C57Bl/6J-Bone Marrow Macrophages	WT	GSM2360198	28383283;
GSE99787_4	C57BL/6-BMDM treated with LPS for 4h	Inflammatory response	GSM2652250; GSM2652251	NA;
GSE99787_4_alt	C57BL/6-BMDM treated with LPS for 4h	Inflammatory response	GSM2652250; GSM2652251	NA;
SRR618774,618775	MEF	WT	SRR618774; SRR618775	22927429;

Database information

Database Name	CCDS_project
Original ID	CCDS52608.1
Cell lines Or Tissues	NA
Phenotype	NULL
Gene ID	ENSMUSG00000063253
Transcript ID	ENSMUST00000167525
Symbol	Scoc
ORF Type	sORF
Gene Type	protein_coding
Interaction	NA
Function Description	NA
PMID	19498102; 22434842; 24217909;

Literature information

PMID	26364619;
Cell lines Or Tissues	NA
Phenotype	NULL
Gene ID	ENSMUSG00000063253
Transcript ID	ENSMUST00000167525
Symbol	Scoc
ORF Type	sORF
Gene Type	protein_coding
Throughput	High-throughput Literature Mining
Interaction	NA
Function Description	NA

Mass Spectrometry Information

No results

Function and Disease

Functional domain prediction

Analysis	Signature Accession	Signature Description	Start location	Stop location	Score	Status of the match	InterPro accession	InterPro description	Pathways
Pfam	PF10224	Short coiled-coil protein	3	76	3.7E-28	T	IPR019357	Short coiled-coil protein	Reactome: R-HSA-6811440
PANTHER	PTHR21614		1	82	4.5E-44	T	IPR019357	Short coiled-coil protein	Reactome: R-HSA-6811440
Coils	Coil		20	54	-	T
Gene3D	G3DSA:1.20.5.170		1	82	2.5E-44	T

Related Small Proteins with Different TISs

SmProt ID	Small Protein Length	Start Codon	Strand	Blocks
SPROMMU86568	81	ATG	-	83435897-83436040, 83437552-83437636, 83437984-83438003
SPROMMU172224	86	CTG	-	83435897-83436040, 83437552-83437636, 83437984-83438018

a reliable repository with comprehensive annotation of small proteins derived from ribosome profiling