SmProt

Specific Information of Small Protein : SPROHSA76068

General Information

Small Protein ID	SPROHSA76068
Organism	Human (Homo sapiens)
Small Protein Sequence	RHGYCTLGEAFNRLDFSSAIQDIRRFNYVVK
RNA Sequence	AGGCATGGCTATTGCACCTTGGGAGAAGCCTTTAATCGGTTAGACTTCTCAAGTGCAATTCAAGATATCCGAAGGTTCAATTATGTGGTCAAA
Protein Length	31
Start Codon	AGG
Location	chr1:805798-805891:-
Blocks	805798-805891
Mean PhyloCSF	-6.33760214877
Data Source	Ribosome profiling;
Related Genes	ENSG00000230021; AL669831.3; ENSG00000237491; AL669831.5; ENSG00000230092; AL669831.4; NONHSAG000044;NONHSAG000046;NONHSAG057401;
Mass (Da)	mono. 3674.9; avg. 3677.1

Ribosome profiling

Ribo-seq ID	Ensembl Gene ID	Ensembl Transcript ID	Symbol	Gene Type	TIS Type	Ribo P value	TIS P value	Start On Trans	Stop On Trans	In-frame Count	Ribo-seq RPKM
GSE94454_alt	ENSG00000230092.7	ENST00000590817.3	AL669831.4	Transcribed_unprocessed_pseudogene	Novel	0.027627	None	145	238	14	6.70128626

Min Ribo P value	0.027627
Min TIS P value	None

Ribo-seq ID	Cell or Tissue	Phenotype	Ribo-seq Source Details	PMID
GSE94454_alt	Huh7	Hepatoma	GSM2476003; GSM2476004; GSM2476005	28323820;

Database information

No results

Literature information

No results

Mass Spectrometry Information

No results

Function and Disease

Functional domain prediction

Analysis	Signature Accession	Signature Description	Start location	Stop location	Score	Status of the match	InterPro accession	InterPro description	GO	Pathways
No results

Disease	Detected
No results

Related Variants

Variant ID	Consequence to sORF	rsID	Ribo-seq ID
No results

Related Small Proteins with Different TISs

SmProt ID	Small Protein Length	Start Codon	Strand	Blocks
SPROHSA76067	31	AGG	-	224030703-224030796
SPROHSA26507	59	AAG	-	805798-805891, 808573-808623, 810066-810100