SmProt

Specific Information of Small Protein : SPROHSA76067

General Information

Small Protein ID	SPROHSA76067
Organism	Human (Homo sapiens)
Small Protein Sequence	RHGYCTLGEAFNRLDFSSAIQDIRRFNYVVK
RNA Sequence	AGGCATGGCTATTGCACCTTGGGAGAAGCCTTTAATCGGTTAGACTTCTCAAGTGCAATTCAAGATATCCGAAGGTTCAATTATGTGGTCAAA
Protein Length	31
Start Codon	AGG
Location	chr1:224030703-224030796:-
Blocks	224030703-224030796
Mean PhyloCSF	3.88903226006
Data Source	Ribosome profiling;
Related Genes	ENSG00000229930; AC138393.2; NONHSAG057260;NONHSAG004419;
Mass (Da)	mono. 3674.9; avg. 3677.1

Ribosome profiling

Ribo-seq ID	Ensembl Gene ID	Ensembl Transcript ID	Symbol	Gene Type	TIS Type	Ribo P value	TIS P value	Start On Trans	Stop On Trans	In-frame Count	Ribo-seq RPKM
GSE94454_alt	ENSG00000229930.1	ENST00000414742.1	AC138393.2	Unprocessed_pseudogene	Novel	0.000785	None	153	246	13	6.22262296

Min Ribo P value	0.000785
Min TIS P value	None

Ribo-seq ID	Cell or Tissue	Phenotype	Ribo-seq Source Details	PMID
GSE94454_alt	Huh7	Hepatoma	GSM2476003; GSM2476004; GSM2476005	28323820;

Database information

No results

Literature information

No results

Mass Spectrometry Information

No results

Function and Disease

Functional domain prediction

Analysis	Signature Accession	Signature Description	Start location	Stop location	Score	Status of the match	InterPro accession	InterPro description	GO	Pathways
PANTHER	PTHR13123		1	31	1.2E-17	T	IPR040394	F-box only protein 25/32
PANTHER	PTHR13123:SF8		1	31	1.2E-17	T

Disease	Detected
No results

Related Variants

Variant ID	Consequence to sORF	rsID	Ribo-seq ID
No results

Related Small Proteins with Different TISs

SmProt ID	Small Protein Length	Start Codon	Strand	Blocks
SPROHSA76068	31	AGG	-	805798-805891
SPROHSA26507	59	AAG	-	805798-805891, 808573-808623, 810066-810100