Specific Information of Small Protein : SPROHSA311389
General Information
Small Protein ID | SPROHSA311389 |
Organism | Human (Homo sapiens) |
Small Protein Sequence | LSGDRCTLSSLGKTQRRLGIFLGGRGPAPRRHHVPGDPVLR |
RNA Sequence | CTGTCCGGGGATCGCTGCACGCTGAGCTCCCTCGGCAAGACCCAGCGGCGGCTCGGGATTTTTTTGGGGGGGCGGGGACCAGCCCCGCGCCGGCACCATGTTCCTGGCGACCCTGTACTTCGC |
Protein Length | 41 |
Start Codon | CTG |
Location | chr10:116272003-116272126:- |
Blocks | 116272003-116272126 |
Mean PhyloCSF | -5.02729269063 |
Data Source | Ribosome profiling; |
Related Genes | ENSG00000151892; GFRA1; |
Mass (Da) | mono. 4432.4; avg. 4435.1 |
Ribosome profiling
Min Ribo P value | 0.004433 |
Min TIS P value | None |
Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
---|
SRR5350740_alt | MCF7 | Breast adenocarcinoma | GSM2538884 | 28388414; |
Mass Spectrometry Information
Function and Disease
Functional domain prediction |      |
Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
---|
MobiDBLite | mobidb-lite | consensus disorder prediction | 21 | 41 | - | T | | | | |
Disease | Detected |
---|
No results |
Related Variants
Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
---|
10-116272107-G-A | Non-Synonymous p.T7M | rs2577360 | SRR2818787; SRR3208885; SRR3208921; SRR5047770; SRR5350740; SRR5990809; SRR5990810; SRR5990811; SRR6838651; SRR8310197; SRR8310201; SRR8310198; SRR8310199; SRR8310200; SRR8310205; SRR810100; SRR810101; SRR1795427 |
Related Small Proteins with Different TISs