Specific Information of Small Protein : SPROHSA259029
General Information
Small Protein ID | SPROHSA259029 |
Organism | Human (Homo sapiens) |
Small Protein Sequence | LSSLGKTQRRLGIFLGGRGPAPRRHHVPGDPVLR |
RNA Sequence | CTGAGCTCCCTCGGCAAGACCCAGCGGCGGCTCGGGATTTTTTTGGGGGGGCGGGGACCAGCCCCGCGCCGGCACCATGTTCCTGGCGACCCTGTACTTCGC |
Protein Length | 34 |
Start Codon | CTG |
Location | chr10:116272003-116272105:- |
Blocks | 116272003-116272105 |
Mean PhyloCSF | -4.49805882047 |
Data Source | Ribosome profiling; |
Related Genes | ENSG00000151892; GFRA1; |
Mass (Da) | mono. 3700.1; avg. 3702.3 |
Ribosome profiling
Min Ribo P value | 0.006774 |
Min TIS P value | None |
Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
---|
GSE123564_2_alt | Skin fibroblasts: Hbs1L-deficient | Facial dysmorphism, growth restriction and retinal deposits | GSM3507223; GSM3507224; GSM3507225; GSM3507228; GSM3507229; GSM3507230 | 30707697; |
Mass Spectrometry Information
Function and Disease
Functional domain prediction |      |
Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
---|
MobiDBLite | mobidb-lite | consensus disorder prediction | 13 | 34 | - | T | | | | |
Disease | Detected |
---|
No results |
Related Variants
Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
---|
No results |
Related Small Proteins with Different TISs