SmProt

Specific Information of Small Protein : SPROHSA77998

General Information

Small Protein ID	SPROHSA77998
Organism	Human (Homo sapiens)
Small Protein Sequence	RPRILRKFWEVWAWRLSVPDPRRGFVPALSGVRGQRARRRSGERSGGGSGHGRSGRR*
RNA Sequence	AGGCCGAGAATACTGCGCAAATTCTGGGAGGTTTGGGCCTGGCGGCTCTCCGTTCCCGACCCCCGGCGTGGATTCGTTCCCGCGCTTTCTGGCGTGAGGGGTCAGAGGGCGCGCCGACGCTCAGGCGAACGGAGCGGAGGCGGCAGCGGCCATGGGCGAAGCGGGCGCCGCTGA
Protein Length	57
Start Codon	AGG
Location	chr21:43658073-43658247:-
Blocks	43658073-43658247
Mean PhyloCSF	-6.64429882888
Data Source	Ribosome profiling;
Related Genes	ENSG00000160207; HSF2BP;
Mass (Da)	mono. 6520.6; avg. 6524.4

Ribosome profiling

Ribo-seq ID	Ensembl Gene ID	Ensembl Transcript ID	Symbol	Gene Type	TIS Type	Ribo P value	TIS P value	Start On Trans	Stop On Trans	In-frame Count	Ribo-seq RPKM
SRR7207252_alt	ENSG00000160207.9	ENST00000443485.1	HSF2BP	Protein_coding	5'UTR	0.035757	None	158	332	5	7.59924275
SRR7207252_alt	ENSG00000160207.9	ENST00000291560.7	HSF2BP	Protein_coding	5'UTR	0.035757	None	176	350	5	7.59924275

Min Ribo P value	0.035757
Min TIS P value	None

Ribo-seq ID	Cell or Tissue	Phenotype	Ribo-seq Source Details	PMID
SRR7207252_alt	MCF10A-ER-Src	Breast adenocarcinoma	GSM3150265	30089253;

Database information

No results

Literature information

No results

Mass Spectrometry Information

No results

Function and Disease

Functional domain prediction

Analysis	Signature Accession	Signature Description	Start location	Stop location	Score	Status of the match	InterPro accession	InterPro description	GO	Pathways
No results

Disease	Detected
No results

Related Variants

Variant ID	Consequence to sORF	rsID	Ribo-seq ID
21-43658154-C-T	Non-Synonymous p.V32M	rs2838343	SRR5382423; SRR6053333; SRR3680966; SRR3680967; SRR618771; SRR618773

Related Small Proteins with Different TISs

SmProt ID	Small Protein Length	Start Codon	Strand	Blocks
SPROHSA273594	53	CTG	-	43658073-43658235