Specific Information of Small Protein : SPROHSA273594
General Information
Small Protein ID | SPROHSA273594 |
Organism | Human (Homo sapiens) |
Small Protein Sequence | LRKFWEVWAWRLSVPDPRRGFVPALSGVRGQRARRRSGERSGGGSGHGRSGRR* |
RNA Sequence | CTGCGCAAATTCTGGGAGGTTTGGGCCTGGCGGCTCTCCGTTCCCGACCCCCGGCGTGGATTCGTTCCCGCGCTTTCTGGCGTGAGGGGTCAGAGGGCGCGCCGACGCTCAGGCGAACGGAGCGGAGGCGGCAGCGGCCATGGGCGAAGCGGGCGCCGCTGA |
Protein Length | 53 |
Start Codon | CTG |
Location | chr21:43658073-43658235:- |
Blocks | 43658073-43658235 |
Mean PhyloCSF | -6.63769132414 |
Data Source | Ribosome profiling; |
Related Genes | ENSG00000160207; HSF2BP; |
Mass (Da) | mono. 5998.2; avg. 6001.7 |
Ribosome profiling
Ribo-seq ID | Ensembl Gene ID | Ensembl Transcript ID | Symbol | Gene Type | TIS Type | Ribo P value | TIS P value | Start On Trans | Stop On Trans | In-frame Count | Ribo-seq RPKM |
---|
SRR618770,618771,618772,618773_alt | ENSG00000160207.9 | ENST00000443485.1 | HSF2BP | Protein_coding | 5'UTR | 0.042715 | 0.004481 | 170 | 332 | 5 | 5.21041359 |
SRR618770,618771,618772,618773_alt | ENSG00000160207.9 | ENST00000291560.7 | HSF2BP | Protein_coding | 5'UTR | 0.042715 | 0.000405 | 188 | 350 | 5 | 5.21041359 |
Min Ribo P value | 0.042715 |
Min TIS P value | 0.000405 |
Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
---|
SRR618770,618771,618772,618773_alt | HEK293 | WT | SRR618770; SRR618771; SRR618772; SRR618773 | NA; |
Mass Spectrometry Information
Function and Disease
Functional domain prediction |       |
Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
---|
No results |
Disease | Detected |
---|
No results |
Related Variants
Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
---|
21-43658154-C-T | Non-Synonymous p.V28M | rs2838343 | SRR5382423; SRR6053333; SRR3680966; SRR3680967; SRR618771; SRR618773 |
Related Small Proteins with Different TISs
SmProt ID | Small Protein Length | Start Codon | Strand | Blocks |
---|
SPROHSA77998 | 57 | AGG | - | 43658073-43658247 |