SmProt

Specific Information of Small Protein : SPROHSA273594

General Information

Small Protein ID	SPROHSA273594
Organism	Human (Homo sapiens)
Small Protein Sequence	LRKFWEVWAWRLSVPDPRRGFVPALSGVRGQRARRRSGERSGGGSGHGRSGRR*
RNA Sequence	CTGCGCAAATTCTGGGAGGTTTGGGCCTGGCGGCTCTCCGTTCCCGACCCCCGGCGTGGATTCGTTCCCGCGCTTTCTGGCGTGAGGGGTCAGAGGGCGCGCCGACGCTCAGGCGAACGGAGCGGAGGCGGCAGCGGCCATGGGCGAAGCGGGCGCCGCTGA
Protein Length	53
Start Codon	CTG
Location	chr21:43658073-43658235:-
Blocks	43658073-43658235
Mean PhyloCSF	-6.63769132414
Data Source	Ribosome profiling;
Related Genes	ENSG00000160207; HSF2BP;
Mass (Da)	mono. 5998.2; avg. 6001.7

Ribosome profiling

Ribo-seq ID	Ensembl Gene ID	Ensembl Transcript ID	Symbol	Gene Type	TIS Type	Ribo P value	TIS P value	Start On Trans	Stop On Trans	In-frame Count	Ribo-seq RPKM
SRR618770,618771,618772,618773_alt	ENSG00000160207.9	ENST00000443485.1	HSF2BP	Protein_coding	5'UTR	0.042715	0.004481	170	332	5	5.21041359
SRR618770,618771,618772,618773_alt	ENSG00000160207.9	ENST00000291560.7	HSF2BP	Protein_coding	5'UTR	0.042715	0.000405	188	350	5	5.21041359

Min Ribo P value	0.042715
Min TIS P value	0.000405

Ribo-seq ID	Cell or Tissue	Phenotype	Ribo-seq Source Details	PMID
SRR618770,618771,618772,618773_alt	HEK293	WT	SRR618770; SRR618771; SRR618772; SRR618773	NA;

Database information

No results

Literature information

No results

Mass Spectrometry Information

No results

Function and Disease

Functional domain prediction

Analysis	Signature Accession	Signature Description	Start location	Stop location	Score	Status of the match	InterPro accession	InterPro description	GO	Pathways
No results

Disease	Detected
No results

Related Variants

Variant ID	Consequence to sORF	rsID	Ribo-seq ID
21-43658154-C-T	Non-Synonymous p.V28M	rs2838343	SRR5382423; SRR6053333; SRR3680966; SRR3680967; SRR618771; SRR618773

Related Small Proteins with Different TISs

SmProt ID	Small Protein Length	Start Codon	Strand	Blocks
SPROHSA77998	57	AGG	-	43658073-43658247