Specific Information of Small Protein : SPROHSA299944
General Information
| Small Protein ID | SPROHSA299944 |
| Organism | Human (Homo sapiens) |
| Small Protein Sequence | LGARRKTALKACLSPARPKEPTLPALQLPYFRRLFS* |
| RNA Sequence | CTGGGAGCCCGACGGAAAACTGCGCTAAAGGCTTGTCTTTCCCCTGCCCGACCGAAGGAGCCGACCTTGCCTGCGCTACAGCTTCCTTATTTTCGTCGCCTGTTCTCCTGA |
| Protein Length | 36 |
| Start Codon | CTG |
| Location | chr22:45413742-45413853:+ |
| Blocks | 45413742-45413853 |
| Mean PhyloCSF | -4.63027023866 |
| Data Source | Ribosome profiling; |
| Related Genes | ENSG00000128408; RIBC2; |
| Mass (Da) | mono. 4065.3; avg. 4067.9 |
Ribosome profiling
| Ribo-seq ID | Ensembl Gene ID | Ensembl Transcript ID | Symbol | Gene Type | TIS Type | Ribo P value | TIS P value | Start On Trans | Stop On Trans | In-frame Count | Ribo-seq RPKM |
|---|
| GSE105082_alt | ENSG00000128408.8 | ENST00000614167.1 | RIBC2 | Protein_coding | 5'UTR | 0.000114 | None | 52 | 163 | 15 | 9.18308478 |
| GSE94454_alt | ENSG00000128408.8 | ENST00000614167.1 | RIBC2 | Protein_coding | 5'UTR | 0.001382 | None | 52 | 163 | 12 | 4.81250674 |
| SRR618770,618771,618772,618773_alt | ENSG00000128408.8 | ENST00000614167.1 | RIBC2 | Protein_coding | 5'UTR | 5.113E-07 | 1.066E-11 | 52 | 163 | 37 | 56.2724667 |
| SRR964946_alt | ENSG00000128408.8 | ENST00000614167.1 | RIBC2 | Protein_coding | 5'UTR | 0.003458 | 0.030913 | 52 | 163 | NA | NA |
| Min Ribo P value | 5.113E-07 |
| Min TIS P value | 1.066E-11 |
| Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
|---|
| GSE105082_alt | HELA | Cervical cancer | GSM2817679; GSM2817680 | 30591072; |
| GSE94454_alt | Huh7 | Hepatoma | GSM2476003; GSM2476004; GSM2476005 | 28323820; |
| SRR618770,618771,618772,618773_alt | HEK293 | WT | SRR618770; SRR618771; SRR618772; SRR618773 | NA; |
| SRR964946_alt | HEK293 | WT | SRR964946 | 22927429; |
Mass Spectrometry Information
Function and Disease
| Functional domain prediction |  |
| Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
|---|
| No results |
| Disease | Detected |
|---|
| No results |
Related Variants
| Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
|---|
| 22-45413743-C-A | Non-Synonymous p.L1M | rs2272804 | SRR5350740; SRR5350745; SRR1795425; SRR1795427; SRR618771; SRR618773 |
| 22-45413817-G-A | Synonymous p.A25A | rs2272805 | SRR5239057; SRR618770; SRR618771 |
Related Small Proteins with Different TISs
SmProt