Specific Information of Small Protein : SPROHSA234589
General Information
Small Protein ID | SPROHSA234589 |
Organism | Human (Homo sapiens) |
Small Protein Sequence | IRSRAFWREGSEGAPTLRRTERRRQRPWAKRAPLRRPAGTWELKRNLLKSERRIWNG* |
RNA Sequence | ATTCGTTCCCGCGCTTTCTGGCGTGAGGGGTCAGAGGGCGCGCCGACGCTCAGGCGAACGGAGCGGAGGCGGCAGCGGCCATGGGCGAAGCGGGCGCCGCTGAGGAGGCCTGCCGGCACATGGGAACTAAAGAGGAATTTGTTAAAGTCAGAAAGAAGGATCTGGAACGGCTGA |
Protein Length | 57 |
Start Codon | ATT |
Location | chr21:43656679-43658176:- |
Blocks | 43656679-43656737,43658060-43658176 |
Mean PhyloCSF | -7.82013796527 |
Data Source | Ribosome profiling; |
Related Genes | ENSG00000160207; HSF2BP; |
Mass (Da) | mono. 6963.9; avg. 6967.9 |
Ribosome profiling
Ribo-seq ID | Ensembl Gene ID | Ensembl Transcript ID | Symbol | Gene Type | TIS Type | Ribo P value | TIS P value | Start On Trans | Stop On Trans | In-frame Count | Ribo-seq RPKM |
---|
GSE45833_2_alt | ENSG00000160207.9 | ENST00000443485.1 | HSF2BP | Protein_coding | 5'UTR | 0.011501 | None | 229 | 403 | 9 | 7.10279316 |
GSE45833_2_alt | ENSG00000160207.9 | ENST00000291560.7 | HSF2BP | Protein_coding | 5'UTR | 0.011501 | None | 247 | 421 | 9 | 7.10279316 |
Min Ribo P value | 0.011501 |
Min TIS P value | None |
Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
---|
GSE45833_2_alt | BJ cells | Quiescence | GSM1047586; GSM1047587 | 23594524; |
Mass Spectrometry Information
Function and Disease
Functional domain prediction |       |
Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
---|
No results |
Disease | Detected |
---|
No results |
Related Variants
Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
---|
21-43658154-C-T | Non-Synonymous p.R8H | rs2838343 | SRR5382423; SRR6053333; SRR3680966; SRR3680967; SRR618771; SRR618773 |
Related Small Proteins with Different TISs
SmProt ID | Small Protein Length | Start Codon | Strand | Blocks |
---|
SPROHSA235490 | 74 | ATT | - | 43656679-43656737, 43658060-43658227 |