SmProt

Specific Information of Small Protein : SPROHSA234589

General Information

Small Protein ID	SPROHSA234589
Organism	Human (Homo sapiens)
Small Protein Sequence	IRSRAFWREGSEGAPTLRRTERRRQRPWAKRAPLRRPAGTWELKRNLLKSERRIWNG*
RNA Sequence	ATTCGTTCCCGCGCTTTCTGGCGTGAGGGGTCAGAGGGCGCGCCGACGCTCAGGCGAACGGAGCGGAGGCGGCAGCGGCCATGGGCGAAGCGGGCGCCGCTGAGGAGGCCTGCCGGCACATGGGAACTAAAGAGGAATTTGTTAAAGTCAGAAAGAAGGATCTGGAACGGCTGA
Protein Length	57
Start Codon	ATT
Location	chr21:43656679-43658176:-
Blocks	43656679-43656737,43658060-43658176
Mean PhyloCSF	-7.82013796527
Data Source	Ribosome profiling;
Related Genes	ENSG00000160207; HSF2BP;
Mass (Da)	mono. 6963.9; avg. 6967.9

Ribosome profiling

Ribo-seq ID	Ensembl Gene ID	Ensembl Transcript ID	Symbol	Gene Type	TIS Type	Ribo P value	TIS P value	Start On Trans	Stop On Trans	In-frame Count	Ribo-seq RPKM
GSE45833_2_alt	ENSG00000160207.9	ENST00000443485.1	HSF2BP	Protein_coding	5'UTR	0.011501	None	229	403	9	7.10279316
GSE45833_2_alt	ENSG00000160207.9	ENST00000291560.7	HSF2BP	Protein_coding	5'UTR	0.011501	None	247	421	9	7.10279316

Min Ribo P value	0.011501
Min TIS P value	None

Ribo-seq ID	Cell or Tissue	Phenotype	Ribo-seq Source Details	PMID
GSE45833_2_alt	BJ cells	Quiescence	GSM1047586; GSM1047587	23594524;

Database information

No results

Literature information

No results

Mass Spectrometry Information

No results

Function and Disease

Functional domain prediction

Analysis	Signature Accession	Signature Description	Start location	Stop location	Score	Status of the match	InterPro accession	InterPro description	GO	Pathways
No results

Disease	Detected
No results

Related Variants

Variant ID	Consequence to sORF	rsID	Ribo-seq ID
21-43658154-C-T	Non-Synonymous p.R8H	rs2838343	SRR5382423; SRR6053333; SRR3680966; SRR3680967; SRR618771; SRR618773

Related Small Proteins with Different TISs

SmProt ID	Small Protein Length	Start Codon	Strand	Blocks
SPROHSA235490	74	ATT	-	43656679-43656737, 43658060-43658227