SmProt

Specific Information of Small Protein : SPROHSA215407

General Information

Small Protein ID	SPROHSA215407
Organism	Human (Homo sapiens)
Small Protein Sequence	MSRFALPALGIPLFPSASAALPFSGAQLWSFHPARQRGEGARAASG*
RNA Sequence	ATGTCCCGCTTTGCGCTCCCGGCCCTGGGCATCCCGCTGTTTCCCTCTGCGTCCGCGGCCCTGCCCTTTTCGGGGGCACAGCTGTGGTCTTTCCACCCCGCGAGACAGCGGGGCGAGGGGGCGCGGGCGGCCAGTGGATAG
Protein Length	46
Start Codon	ATG
Location	chr1:11680802-11680943:-
Blocks	11680802-11680943
Mean PhyloCSF	-6.01775176178
Data Source	Ribosome profiling;
Related Genes	ENSG00000116670; MAD2L2;
Mass (Da)	mono. 4751.5; avg. 4754.4

Ribosome profiling

Ribo-seq ID	Ensembl Gene ID	Ensembl Transcript ID	Symbol	Gene Type	TIS Type	Ribo P value	TIS P value	Start On Trans	Stop On Trans	In-frame Count	Ribo-seq RPKM
GSE45785_2	ENSG00000116670.15	ENST00000456915.1	MAD2L2	Protein_coding	5'UTR	0.034576	None	188	329	5	20.9919781
GSE45785_2_alt	ENSG00000116670.15	ENST00000456915.1	MAD2L2	Protein_coding	5'UTR	0.034576	None	188	329	5	20.9919781
SRR3317843	ENSG00000116670.15	ENST00000456915.1	MAD2L2	Protein_coding	5'UTR	0.035457	None	188	329	4	23.8739301
SRR3317843_alt	ENSG00000116670.15	ENST00000456915.1	MAD2L2	Protein_coding	5'UTR	0.035457	None	188	329	4	23.8739301
GSE94454	ENSG00000116670.15	ENST00000456915.1	MAD2L2	Protein_coding	5'UTR	0.001096	None	188	329	12	3.78856913
SRR5047770	ENSG00000116670.15	ENST00000456915.1	MAD2L2	Protein_coding	5'UTR	0.026819	None	188	329	7	3.93887489
SRR7207252	ENSG00000116670.15	ENST00000456915.1	MAD2L2	Protein_coding	5'UTR	0.005674	None	188	329	6	11.2533467
GSE83493	ENSG00000116670.15	ENST00000456915.1	MAD2L2	Protein_coding	5'UTR	0.048542	None	188	329	34	28.8977731
GSE83493_alt	ENSG00000116670.15	ENST00000456915.1	MAD2L2	Protein_coding	5'UTR	0.048542	None	188	329	34	28.8977731
SRR618770,618771,618772,618773_alt	ENSG00000116670.15	ENST00000456915.1	MAD2L2	Protein_coding	5'UTR	6.105E-06	1.334E-10	188	329	39	46.6941745
SRR964946_alt	ENSG00000116670.15	ENST00000456915.1	MAD2L2	Protein_coding	5'UTR	0.010742	0.032022	188	329	NA	NA

Min Ribo P value	6.105E-06
Min TIS P value	1.334E-10

Ribo-seq ID	Cell or Tissue	Phenotype	Ribo-seq Source Details	PMID
GSE45785_2	BJ cells	Immortalized	GSM1115207	23594524;
GSE45785_2_alt	BJ cells	Immortalized	GSM1115207	23594524;
GSE83493	HeLa S3	Cervical cancer	GSM2204389; GSM2204390; GSM2204391; GSM2204392	28460002;
GSE83493_alt	HeLa S3	Cervical cancer	GSM2204389; GSM2204390; GSM2204391; GSM2204392	28460002;
GSE94454	Huh7	Hepatoma	GSM2476003; GSM2476004; GSM2476005	28323820;
SRR3317843	U2OS cells	WT	GSM2103080	27406171;
SRR3317843_alt	U2OS cells	WT	GSM2103080	27406171;
SRR5047770	iPSC-differentiated dopamine neurons	Parkinson Disease	GSM2402496; GSM2402497; GSM2402498	NA;
SRR618770,618771,618772,618773_alt	HEK293	WT	SRR618770; SRR618771; SRR618772; SRR618773	NA;
SRR7207252	MCF10A-ER-Src	Breast adenocarcinoma	GSM3150265	30089253;
SRR964946_alt	HEK293	WT	SRR964946	22927429;

Database information

No results

Literature information

No results

Mass Spectrometry Information

No results

Function and Disease

Functional domain prediction

Analysis	Signature Accession	Signature Description	Start location	Stop location	Score	Status of the match	InterPro accession	InterPro description	GO	Pathways
No results

Disease	Detected
No results

Related Variants

Variant ID	Consequence to sORF	rsID	Ribo-seq ID
No results

Related Small Proteins with Different TISs

SmProt ID	Small Protein Length	Start Codon	Strand	Blocks
SPROHSA317660	34	CTG	-	11680802-11680907