Specific Information of Small Protein : SPROHSA152824
General Information
Small Protein ID | SPROHSA152824 |
Organism | Human (Homo sapiens) |
Small Protein Sequence | MSLPQTPDLWVRPFNGQRLAEEGSPAFLGTERSRVVRG* |
RNA Sequence | ATGAGCCTTCCGCAAACTCCTGACCTGTGGGTCCGTCCGTTCAACGGCCAAAGGCTGGCGGAGGAGGGATCCCCTGCCTTTCTCGGAACGGAACGGAGCAGAGTCGTGCGTGGTTGA |
Protein Length | 38 |
Start Codon | ATG |
Location | chr11:5596651-5596768:+ |
Blocks | 5596651-5596768 |
Mean PhyloCSF | -7.2806153542 |
Data Source | Ribosome profiling; |
Related Genes | ENSG00000239920; AC104389.4; ENSG00000258588; TRIM6-TRIM34; ENSG00000121236; TRIM6; NONHSAG007512; |
Mass (Da) | mono. 4253.2; avg. 4255.8 |
Ribosome profiling
Ribo-seq ID | Ensembl Gene ID | Ensembl Transcript ID | Symbol | Gene Type | TIS Type | Ribo P value | TIS P value | Start On Trans | Stop On Trans | In-frame Count | Ribo-seq RPKM |
---|
SRR4045276 | ENSG00000121236.21 | ENST00000380097.8 | TRIM6 | Protein_coding | 5'UTR | 0.035132 | None | 15 | 132 | 5 | 10.1214124 |
GSE45833_6 | ENSG00000121236.21 | ENST00000380097.8 | TRIM6 | Protein_coding | 5'UTR | 0.035132 | None | 15 | 132 | 5 | 7.30226079 |
SRR4045276_alt | ENSG00000121236.21 | ENST00000380097.8 | TRIM6 | Protein_coding | 5'UTR | 0.035132 | None | 15 | 132 | 5 | 10.1214124 |
GSE45833_6_alt | ENSG00000121236.21 | ENST00000380097.8 | TRIM6 | Protein_coding | 5'UTR | 0.035132 | None | 15 | 132 | 5 | 7.30226079 |
GSE105082 | ENSG00000121236.21 | ENST00000380097.8 | TRIM6 | Protein_coding | 5'UTR | 0.040199 | None | 15 | 132 | 11 | 6.38891539 |
GSE105082_alt | ENSG00000121236.21 | ENST00000380097.8 | TRIM6 | Protein_coding | 5'UTR | 0.040199 | None | 15 | 132 | 11 | 6.38891539 |
GSE58207_alt | ENSG00000121236.21 | ENST00000380097.8 | TRIM6 | Protein_coding | 5'UTR | 0.026411 | 0.012769 | 15 | 132 | 71 | 62.4960910 |
Min Ribo P value | 0.026411 |
Min TIS P value | None |
Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
---|
GSE105082 | HELA | Cervical cancer | GSM2817679; GSM2817680 | 30591072; |
GSE105082_alt | HELA | Cervical cancer | GSM2817679; GSM2817680 | 30591072; |
GSE45833_6 | BJ cells | Transformed | GSM1047591 | 23594524; |
GSE45833_6_alt | BJ cells | Transformed | GSM1047591 | 23594524; |
GSE58207_alt | HCT116 | Colorectal carcinoma | GSM1403307; GSM1403308 | 25510491; |
SRR4045276 | Meg01 cells | WT | GSM2285909 | 27681415; |
SRR4045276_alt | Meg01 cells | WT | GSM2285909 | 27681415; |
Mass Spectrometry Information
Function and Disease
Functional domain prediction |      |
Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
---|
No results |
Disease | Detected |
---|
No results |
Related Variants
Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
---|
11-5596757-G-A | Non-Synonymous p.V36M | rs12272467 | SRR7182550; SRR618773 |
Related Small Proteins with Different TISs
SmProt ID | Small Protein Length | Start Codon | Strand | Blocks |
---|
SPROHSA296027 | 20 | CTG | + | 5596705-5596768 |