Specific Information of Small Protein : SPROHSA135925
General Information
Small Protein ID | SPROHSA135925 |
Organism | Human (Homo sapiens) |
Small Protein Sequence | IFEPGPKLWDRRAPHQGRAKDPKEKRKEFMKAEMPGAHEHPSVALDGTSCWATQLKCG* |
RNA Sequence | ATCTTTGAGCCCGGCCCCAAGCTCTGGGACCGTCGTGCCCCTCATCAAGGAAGAGCCAAGGACCCCAAGGAGAAGagaaaggagttcatgaaggcagaaatgcctggggcccacgaacatcccagtgtggccctgGACGGGACATCATGCTGGGCAACACAGCTAAAATGCGGGTGA |
Protein Length | 58 |
Start Codon | ATC |
Location | chr15:57306993-57307643:+ |
Blocks | 57306993-57307068,57307541-57307643 |
Mean PhyloCSF | -7.34132203409 |
Data Source | Ribosome profiling; |
Related Genes | ENSG00000247982; LINC00926; NONHSAG016995; |
Mass (Da) | mono. 6552.3; avg. 6556.5 |
Ribosome profiling
Min Ribo P value | 0.002526 |
Min TIS P value | None |
Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
---|
GSE94613_2_alt | MOLM13 | Acute myeloid leukemia | GSM2481053 | 29186125; |
Mass Spectrometry Information
Function and Disease
Functional domain prediction |      |
Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
---|
MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 29 | - | T | | | | |
Disease | Detected |
---|
Acute myeloid leukemia | Predicted by Ribo-seq |
Related Variants
Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
---|
No results |
Related Small Proteins with Different TISs