Specific Information of Small Protein : SPROHSA135925
General Information
| Small Protein ID | SPROHSA135925 |
| Organism | Human (Homo sapiens) |
| Small Protein Sequence | IFEPGPKLWDRRAPHQGRAKDPKEKRKEFMKAEMPGAHEHPSVALDGTSCWATQLKCG* |
| RNA Sequence | ATCTTTGAGCCCGGCCCCAAGCTCTGGGACCGTCGTGCCCCTCATCAAGGAAGAGCCAAGGACCCCAAGGAGAAGagaaaggagttcatgaaggcagaaatgcctggggcccacgaacatcccagtgtggccctgGACGGGACATCATGCTGGGCAACACAGCTAAAATGCGGGTGA |
| Protein Length | 58 |
| Start Codon | ATC |
| Location | chr15:57306993-57307643:+ |
| Blocks | 57306993-57307068,57307541-57307643 |
| Mean PhyloCSF | -7.34132203409 |
| Data Source | Ribosome profiling; |
| Related Genes | ENSG00000247982; LINC00926; NONHSAG016995; |
| Mass (Da) | mono. 6552.3; avg. 6556.5 |
Ribosome profiling
| Min Ribo P value | 0.002526 |
| Min TIS P value | None |
| Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
|---|
| GSE94613_2_alt | MOLM13 | Acute myeloid leukemia | GSM2481053 | 29186125; |
Mass Spectrometry Information
Function and Disease
| Functional domain prediction |       |
| Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
|---|
| MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 29 | - | T | | | | |
| Disease | Detected |
|---|
| Acute myeloid leukemia | Predicted by Ribo-seq |
Related Variants
| Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
|---|
| No results |
Related Small Proteins with Different TISs