Specific Information of Small Protein : SPROHSA135925
        
	General Information
| Small Protein ID | SPROHSA135925 | 
| Organism | Human (Homo sapiens) | 
| Small Protein Sequence | IFEPGPKLWDRRAPHQGRAKDPKEKRKEFMKAEMPGAHEHPSVALDGTSCWATQLKCG* | 
| RNA Sequence | ATCTTTGAGCCCGGCCCCAAGCTCTGGGACCGTCGTGCCCCTCATCAAGGAAGAGCCAAGGACCCCAAGGAGAAGagaaaggagttcatgaaggcagaaatgcctggggcccacgaacatcccagtgtggccctgGACGGGACATCATGCTGGGCAACACAGCTAAAATGCGGGTGA | 
| Protein Length | 58 | 
| Start Codon | ATC | 
| Location | chr15:57306993-57307643:+ | 
| Blocks | 57306993-57307068,57307541-57307643 | 
| Mean PhyloCSF | -7.34132203409 | 
| Data Source | Ribosome profiling;  | 
| Related Genes | ENSG00000247982; LINC00926; NONHSAG016995; | 
| Mass (Da) | mono. 6552.3; avg. 6556.5 | 
 
Ribosome profiling
| Min Ribo P value | 0.002526 | 
| Min TIS P value | None | 
 
| Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID | 
|---|
| GSE94613_2_alt | MOLM13 | Acute myeloid leukemia | GSM2481053 | 29186125;  | 
 
Mass Spectrometry Information
Function and Disease
| Functional domain prediction |       | 
 
| Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways | 
|---|
| MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 29 | - | T |  |  |  |  | 
| Disease | Detected | 
|---|
| Acute myeloid leukemia | Predicted by Ribo-seq | 
 
Related Variants
| Variant ID | Consequence to sORF | rsID | Ribo-seq ID | 
|---|
| No results | 
Related Small Proteins with Different TISs