Specific Information of Small Protein : SPROHSA104051
General Information
Small Protein ID | SPROHSA104051 |
Organism | Human (Homo sapiens) |
Small Protein Sequence | IEDKLENLEKPKQISHIEGKKKNKTKWEGRNVERYTLF* |
RNA Sequence | atagaagataaattagaaaatttggaaaaacccaaacagatcagccatattgaagggaaaaagaaaaacaaaacaaagtgggagggcagaaatgtagaacggtatacactcttttaa |
Protein Length | 38 |
Start Codon | ata |
Location | chr7:102988456-102988573:+ |
Blocks | 102988456-102988573 |
Mean PhyloCSF | -8.15143591318 |
Data Source | Ribosome profiling; |
Related Genes | ENSG00000161040; FBXL13; ENSG00000230257; NFE4; NONHSAG048439; |
Mass (Da) | mono. 4625.5; avg. 4628.2 |
Ribosome profiling
Min Ribo P value | 0.003436 |
Min TIS P value | None |
Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
---|
GSE94613_2_alt | MOLM13 | Acute myeloid leukemia | GSM2481053 | 29186125; |
Mass Spectrometry Information
Function and Disease
Functional domain prediction |      |
Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
---|
No results |
Disease | Detected |
---|
Acute myeloid leukemia | Predicted by Ribo-seq |
Related Variants
Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
---|
No results |
Related Small Proteins with Different TISs
SmProt ID | Small Protein Length | Start Codon | Strand | Blocks |
---|
SPROHSA136706 | 40 | atg | + | 102988450-102988573 |