| General Information |
| Family ID | 51 |
| No. Members | 139 |
| Small Protein Length | 50 |
| Representative AA Seq (detail) | MNKLEKLSESEMNAIIGGESNHGKSGGKWVYDSNTGKWYWVEVCDSTDSK |
| Representative DNA Seq (detail) | ATGAATAAATTGGAAAAATTGTCTGAATCAGAAATGAATGCCATAATTGGAGGCGAAAGTAATCACGGTAAAAGCGGTGGAAAATGGGTGTATGATTCGAATACGGGTAAATGGTATTGGGTCGAGGTTTGTGATTCTACTGACTCTAAATGA |
| Example of a Refseq homolog | WP_008154264.1 |
| Associated HGT genes | OrfB_Zn_ribbon, INT_ICEBs1_C_like, recomb_XerD, PHA02942, XerD, INT_Rci_Hp1_C, INT_IntI_C, DDE_Tnp_1, RecA-like_NTPases, tspaseT_teng_C, INT_C_like_1, OrfB_IS605, Phage_integrase, DNA_BRE_C, Phage_int_SAM_5, INTN1_C_like |
| Number of non bacterial | 0 |
| Non bacterial classification_numbe of members that were classified to it | NA |
| RNA code p-value assigned to family | 0.003 |
| number of species | 13 |
| Species | Parabacteroides johnsonii_43, Bacteroides thetaiotaomicron CAG:40_1, Parabacteroides sp. SN4_73, Bacteroides stercoris_1, Bacteroides sp. UNK.MGS-14_2, Bacteroides sp. 1_1_6_1, Bacteroides vulgatus_1, Bacteroides intestinalis_1, Parabacteroides merdae_10, Bacteroides cellulosilyticus_2, Bacteroides plebeius_1, Bacteroides sp. 14(A)_1, Prevotella copri CAG:164_1 |
| Sample Origin |
| Body Sites | No. Samples | Fraction |
| Mouth | 0 | 0 |
| Skin | 0 | 0 |
| Vagina | 0 | 0 |
| Gut | 66 | 0.267206478 |
| Number of homologs from non-human metagenomes | Number of different types of non-human environments | Non human environments in which homologs exist_number of homologs |
| 0 | NA | NA |
| Function prediction |
| % of family members that are predicted to have a transmembrane domain (TMHMM) | 0 | ||
| Is family classified as Transmembrane (TMHMM) | 0 | ||
| % of family members that are predicted to have a signal peptide in gram+ (SignalP_v5.0) | 0.086330935 | ||
| Is family predicted to be secreted in gram+ (SignalP_v5.0) | 0 | ||
| % of family members that are predicted to have a signal peptide in gram- (SignalP_v5.0) | 0 | ||
| Is family predicted to be secreted in gram- (SignalP_v5.0) | 0 | ||
| Number of members the are transmembrane (Phobius) | 0 | ||
| Fraction of members that are transmembrane (Phobius) | 0 | ||
| Number of members that are secreted (Phobius) | 0 | ||
| Fraction of members that are secreted (Phobius) | 0 | ||
| Number of significant complete CDD hits that were assigned to family representative sequence | 0 | ||
| PSSMs assigned | NA | ||
| Domains assigned | NA | ||
| References |
| PubMed ID | 31402174 |
| Title | Large-Scale Analyses of Human Microbiomes Reveal Thousands of Small, Novel Genes |
| Authors | Hila Sberro, Brayon J. Fremin, Soumaya Zlitni, Fredrik Edfors, Nicholas Greenfield, Michael P. Snyder, Georgios A. Pavlopoulos, Nikos C. Kyrpides, and Ami S. Bhatt |
| Journal | Cell 178, 1–15, August 22, 2019 |