| General Information |
| Family ID | 49 |
| No. Members | 278 |
| Small Protein Length | 50 |
| Representative AA Seq (detail) | MARPIKETPILFGEDARRFEERMKEKRRETPEQRAKRLKDYELAMKIFKK |
| Representative DNA Seq (detail) | ATGGCAAGACCGATTAAAGAAACTCCGATACTTTTCGGAGAAGATGCACGGCGGTTTGAAGAGCGGATGAAAGAAAAACGCAGGGAGACCCCCGAGCAGCGGGCAAAAAGATTGAAGGACTATGAACTGGCAATGAAAATATTTAAAAAATAG |
| Example of a Refseq homolog | NA |
| Associated HGT genes | HTH_Hin_like, PHA02517 |
| Number of non bacterial | 0 |
| Non bacterial classification_numbe of members that were classified to it | NA |
| RNA code p-value assigned to family | 3.79E-13 |
| number of species | 35 |
| Species | Bacteroides faecis_4, Bacteroides sp. 1_1_30_1, Bacteroides finegoldii CAG:203_1, Alistipes putredinis_1, Bacteroides sp. D22_3, Bacteroidales bacterium H10_1, Bacteroides thetaiotaomicron_58, Bacteroides sp. HMSC068A09_1, Bacteroides sp. AR29_1, Bacteroides sp. 1_1_6_6, Bacteroides stercoris_1, Alistipes putredinis CAG:67_1, Prevotella salivae_1, Bacteroides sp. AR20_13, Bacteroides sp. KFT8_2, Bacteroides thetaiotaomicron CAG:40_3, Bacteroides sp. 1_1_14_4, Prevotella sp. F0091_1, Prevotella sp. CAG:732_1, Prevotella sp. CAG:604_3, Bacteroides nordii_3, Prevotella pallens_1, Bacteroides uniformis_1, Prevotella copri CAG:164_5, Unclassified_1, Bacteroides xylanisolvens_11, Prevotella copri_16, Bacteroides sp. 3_1_13_1, Bacteroides sp. HMSC067B03_1, Bacteroides faecis CAG:32_2, Bacteroides rodentium_1, Prevotella sp. HJM029_8, Bacteroides ovatus_60, Bacteroides sp. D2_6, Prevotella oulorum_23, Bacteroides finegoldii_1 |
| Sample Origin |
| Body Sites | No. Samples | Fraction |
| Mouth | 25 | 0.113122172 |
| Skin | 0 | 0 |
| Vagina | 0 | 0 |
| Gut | 132 | 0.534412955 |
| Number of homologs from non-human metagenomes | Number of different types of non-human environments | Non human environments in which homologs exist_number of homologs |
| 1 | 1 | Mammals_1 |
| Function prediction |
| % of family members that are predicted to have a transmembrane domain (TMHMM) | 0 | ||
| Is family classified as Transmembrane (TMHMM) | 0 | ||
| % of family members that are predicted to have a signal peptide in gram+ (SignalP_v5.0) | 0 | ||
| Is family predicted to be secreted in gram+ (SignalP_v5.0) | 0 | ||
| % of family members that are predicted to have a signal peptide in gram- (SignalP_v5.0) | 0 | ||
| Is family predicted to be secreted in gram- (SignalP_v5.0) | 0 | ||
| Number of members the are transmembrane (Phobius) | 0 | ||
| Fraction of members that are transmembrane (Phobius) | 0 | ||
| Number of members that are secreted (Phobius) | 0 | ||
| Fraction of members that are secreted (Phobius) | 0 | ||
| Number of significant complete CDD hits that were assigned to family representative sequence | 0 | ||
| PSSMs assigned | NA | ||
| Domains assigned | NA | ||
| References |
| PubMed ID | 31402174 |
| Title | Large-Scale Analyses of Human Microbiomes Reveal Thousands of Small, Novel Genes |
| Authors | Hila Sberro, Brayon J. Fremin, Soumaya Zlitni, Fredrik Edfors, Nicholas Greenfield, Michael P. Snyder, Georgios A. Pavlopoulos, Nikos C. Kyrpides, and Ami S. Bhatt |
| Journal | Cell 178, 1–15, August 22, 2019 |