| General Information |
| Family ID | 34 |
| No. Members | 31 |
| Small Protein Length | 50 |
| Representative AA Seq (detail) | MQDVRNGADKLVCRIDKTSKTVEIVLKGFKTIVRFLDNGQVLIENVSMVA |
| Representative DNA Seq (detail) | GTGCAAGACGTAAGAAACGGTGCCGACAAACTGGTTTGTCGAATAGATAAAACCAGCAAAACGGTAGAAATTGTCTTAAAGGGATTTAAGACGATTGTTCGATTTTTAGACAACGGACAAGTCTTAATCGAGAATGTAAGTATGGTAGCTTAG |
| Example of a Refseq homolog | WP_022422476.1 |
| Associated HGT genes | Zn_ribbon_recom, SR_ResInv, Recombinase, SR_IS607_transposase_like, PinE, Ser_Recombinase, SR_TndX_transposase |
| Number of non bacterial | 0 |
| Non bacterial classification_numbe of members that were classified to it | NA |
| RNA code p-value assigned to family | 2.17E-08 |
| number of species | 10 |
| Species | Catabacter sp. UBA2915_2, Clostridium sp. CAG:349_48_7_1, Corallococcus sp. CAG:1435_5, Clostridium sp. CAG:307_1, Clostridium sp. CAG:349_2, Firmicutes bacterium CAG:631_1, Firmicutes bacterium CAG:552_39_19_2, Firmicutes bacterium CAG:345_10, Subdoligranulum sp. CAG:314_2, Unclassified_3, Acidaminococcus sp. CAG:917_1 |
| Sample Origin |
| Body Sites | No. Samples | Fraction |
| Mouth | 0 | 0 |
| Skin | 0 | 0 |
| Vagina | 0 | 0 |
| Gut | 22 | 0.089068826 |
| Number of homologs from non-human metagenomes | Number of different types of non-human environments | Non human environments in which homologs exist_number of homologs |
| 0 | NA | NA |
| Function prediction |
| % of family members that are predicted to have a transmembrane domain (TMHMM) | 0 | ||
| Is family classified as Transmembrane (TMHMM) | 0 | ||
| % of family members that are predicted to have a signal peptide in gram+ (SignalP_v5.0) | 0 | ||
| Is family predicted to be secreted in gram+ (SignalP_v5.0) | 0 | ||
| % of family members that are predicted to have a signal peptide in gram- (SignalP_v5.0) | 0 | ||
| Is family predicted to be secreted in gram- (SignalP_v5.0) | 0 | ||
| Number of members the are transmembrane (Phobius) | 0 | ||
| Fraction of members that are transmembrane (Phobius) | 0 | ||
| Number of members that are secreted (Phobius) | 0 | ||
| Fraction of members that are secreted (Phobius) | 0 | ||
| Number of significant complete CDD hits that were assigned to family representative sequence | 0 | ||
| PSSMs assigned | NA | ||
| Domains assigned | NA | ||
| References |
| PubMed ID | 31402174 |
| Title | Large-Scale Analyses of Human Microbiomes Reveal Thousands of Small, Novel Genes |
| Authors | Hila Sberro, Brayon J. Fremin, Soumaya Zlitni, Fredrik Edfors, Nicholas Greenfield, Michael P. Snyder, Georgios A. Pavlopoulos, Nikos C. Kyrpides, and Ami S. Bhatt |
| Journal | Cell 178, 1–15, August 22, 2019 |