| General Information |
| Family ID | 31 |
| No. Members | 134 |
| Small Protein Length | 50 |
| Representative AA Seq (detail) | MSSARGELQYRIALGILGQMRSAGFVTDQEAETIRRLAEEKYRPETVRGS |
| Representative DNA Seq (detail) | ATGAGCAGCGCCAGAGGAGAACTGCAATACCGGATCGCCCTGGGCATCCTGGGGCAGATGCGGTCGGCGGGCTTCGTCACCGACCAGGAGGCGGAAACCATCCGCCGTCTGGCGGAGGAGAAATATCGTCCGGAAACTGTTCGGGGATCGTGA |
| Example of a Refseq homolog | NA |
| Associated HGT genes | SR_ResInv, SR_IS607_transposase_like, zf-IS66, INT_ICEBs1_C_like, PRK09409, Recombinase, SR_TndX_transposase, INT_XerDC_C, INT_RitA_C_like, Zn_ribbon_recom, DEDD_Tnp_IS110, PinE, INT_Rci_Hp1_C, INT_IntI_C, DDE_Tnp_1, LZ_Tnp_IS66, INT_C_like_1, PHA02517, Phage_integrase, DNA_BRE_C, Ser_Recombinase, INTN1_C_like, Transposase_20 |
| Number of non bacterial | 0 |
| Non bacterial classification_numbe of members that were classified to it | NA |
| RNA code p-value assigned to family | 0.000445 |
| number of species | 13 |
| Species | Intestinimonas butyriciproducens_3, Pseudoflavonifractor capillosus_1, Lachnospiraceae bacterium 7_1_58FAA_3, Firmicutes bacterium CAG:176_1, Clostridia bacterium UC5.1-2H11_3, uncultured Oscillibacter sp._2, Oscillibacter sp. CAG:241_2, Clostridium sp. ATCC BAA-442_1, Oscillibacter sp. ER4_1, Anaerofilum sp. An201_1, Ruminococcaceae bacterium 668_1, Unclassified_3, Clostridiales bacterium 42_27_33, Flavonifractor plautii_12 |
| Sample Origin |
| Body Sites | No. Samples | Fraction |
| Mouth | 0 | 0 |
| Skin | 0 | 0 |
| Vagina | 0 | 0 |
| Gut | 89 | 0.360323887 |
| Number of homologs from non-human metagenomes | Number of different types of non-human environments | Non human environments in which homologs exist_number of homologs |
| 12 | 1 | Mammals_12 |
| Function prediction |
| % of family members that are predicted to have a transmembrane domain (TMHMM) | 0 | ||
| Is family classified as Transmembrane (TMHMM) | 0 | ||
| % of family members that are predicted to have a signal peptide in gram+ (SignalP_v5.0) | 0 | ||
| Is family predicted to be secreted in gram+ (SignalP_v5.0) | 0 | ||
| % of family members that are predicted to have a signal peptide in gram- (SignalP_v5.0) | 0 | ||
| Is family predicted to be secreted in gram- (SignalP_v5.0) | 0 | ||
| Number of members the are transmembrane (Phobius) | 0 | ||
| Fraction of members that are transmembrane (Phobius) | 0 | ||
| Number of members that are secreted (Phobius) | 5 | ||
| Fraction of members that are secreted (Phobius) | 0.037313433 | ||
| Number of significant complete CDD hits that were assigned to family representative sequence | 0 | ||
| PSSMs assigned | NA | ||
| Domains assigned | NA | ||
| References |
| PubMed ID | 31402174 |
| Title | Large-Scale Analyses of Human Microbiomes Reveal Thousands of Small, Novel Genes |
| Authors | Hila Sberro, Brayon J. Fremin, Soumaya Zlitni, Fredrik Edfors, Nicholas Greenfield, Michael P. Snyder, Georgios A. Pavlopoulos, Nikos C. Kyrpides, and Ami S. Bhatt |
| Journal | Cell 178, 1–15, August 22, 2019 |