| General Information |
| Family ID | 0 |
| No. Members | 25 |
| Small Protein Length | 50 |
| Representative AA Seq (detail) | MKTLYVYADFDWIEETELVGELGYESLRSSDCYCFTLNDGCFEKNTEICF |
| Representative DNA Seq (detail) | ATGAAGACGCTATATGTATATGCCGATTTTGATTGGATCGAAGAAACAGAACTCGTTGGTGAGTTAGGCTATGAATCTCTTCGTAGCTCGGATTGCTATTGTTTTACTCTCAATGATGGATGTTTTGAAAAAAACACGGAGATTTGTTTTTGA |
| Example of a Refseq homolog | NA |
| Associated HGT genes | PRK09871, INT_ICEBs1_C_like, INT_P4_C, recomb_XerD, XerD, INT_Cre_C, INT_XerDC_C, INT_Rci_Hp1_C, INT_IntI_C, INT_Lambda_C, LZ_Tnp_IS66, INT_C_like_1, Phage_integrase, DNA_BRE_C, Phage_int_SAM_5, INTN1_C_like, INT_RitC_C_like |
| Number of non bacterial | 0 |
| Non bacterial classification_numbe of members that were classified to it | NA |
| RNA code p-value assigned to family | 0.031 |
| number of species | 4 |
| Species | Bacteroides sp. D20_1, Bacteroides fragilis_3, Bacteroides dorei_12, Bacteroides sp. 3_1_19_1 |
| Sample Origin |
| Body Sites | No. Samples | Fraction |
| Mouth | 0 | 0 |
| Skin | 0 | 0 |
| Vagina | 0 | 0 |
| Gut | 24 | 0.097165992 |
| Number of homologs from non-human metagenomes | Number of different types of non-human environments | Non human environments in which homologs exist_number of homologs |
| 0 | NA | NA |
| Function prediction |
| % of family members that are predicted to have a transmembrane domain (TMHMM) | 0 | ||
| Is family classified as Transmembrane (TMHMM) | 0 | ||
| % of family members that are predicted to have a signal peptide in gram+ (SignalP_v5.0) | 0 | ||
| Is family predicted to be secreted in gram+ (SignalP_v5.0) | 0 | ||
| % of family members that are predicted to have a signal peptide in gram- (SignalP_v5.0) | 0 | ||
| Is family predicted to be secreted in gram- (SignalP_v5.0) | 0 | ||
| Number of members the are transmembrane (Phobius) | 0 | ||
| Fraction of members that are transmembrane (Phobius) | 0 | ||
| Number of members that are secreted (Phobius) | 0 | ||
| Fraction of members that are secreted (Phobius) | 0 | ||
| Number of significant complete CDD hits that were assigned to family representative sequence | 0 | ||
| PSSMs assigned | NA | ||
| Domains assigned | NA | ||
| References |
| PubMed ID | 31402174 |
| Title | Large-Scale Analyses of Human Microbiomes Reveal Thousands of Small, Novel Genes |
| Authors | Hila Sberro, Brayon J. Fremin, Soumaya Zlitni, Fredrik Edfors, Nicholas Greenfield, Michael P. Snyder, Georgios A. Pavlopoulos, Nikos C. Kyrpides, and Ami S. Bhatt |
| Journal | Cell 178, 1–15, August 22, 2019 |