Specific Information of Small Protein : SPROMMU221510
General Information
| Small Protein ID | SPROMMU221510 |
| Organism | Mouse (Mus musculus) |
| Small Protein Sequence | VYYQSEWNQCQQRDTCQCHRTCHSLPEIQTANEARFHTVGLRQS* |
| RNA Sequence | GTGTATTATCAAAGTGAATGGAATCAATGTCAGCAAAGAGACACATGCCAGTGTCATCGCACATGTCACAGCCTGCCGGAAATACAAACGGCCAATGAAGCAAGATTCCATACAGTGGGTCTACGACAGTCTTGA |
| Protein Length | 44 |
| Start Codon | GTG |
| Location | chr1:11153579-11156275:+ |
| Blocks | 11153579-11153679,11156240-11156275 |
| Mean PhyloCSF | -8.01924441655 |
| Data Source | Ribosome profiling; |
| Related Genes | ENSMUSG00000048960; Prex2; NONMMUG000100; |
| Mass (Da) | mono. 5250.4; avg. 5253.7 |
Ribosome profiling
| Ribo-seq ID | Ensembl Gene ID | Ensembl Transcript ID | Symbol | Gene Type | TIS Type | Ribo P value | TIS P value | Start On Trans | Stop On Trans | In-frame Count | Ribo-seq RPKM |
|---|
| GSE60095_alt | ENSMUSG00000048960.13 | ENSMUST00000187694.1 | Prex2 | Protein_coding | Novel | 0.049914 | None | 2230 | 2365 | 13 | 3.28800232 |
| GSE60095_alt | ENSMUSG00000048960.13 | ENSMUST00000027056.11 | Prex2 | Protein_coding | Internal | 0.049914 | None | 2454 | 2589 | 13 | 3.28800232 |
| Min Ribo P value | 0.049914 |
| Min TIS P value | None |
| Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
|---|
| GSE60095_alt | ES cell | WT | GSM1464901 | 25159147; |
Mass Spectrometry Information
Function and Disease
| Functional domain prediction |  |
| Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
|---|
| No results |
Related Small Proteins with Different TISs
| SmProt ID | Small Protein Length | Start Codon | Strand | Blocks |
|---|
| No results |
SmProt