SmProt

Specific Information of Small Protein : SPROHSA91191

General Information

Small Protein ID	SPROHSA91191
Organism	Human (Homo sapiens)
Small Protein Sequence	RGFGSLQAQSEHWHDRPVPGCLCCQPVRIQVKSGFL*
RNA Sequence	AGGGGCTTTGGATCCTTACAAGCACAAAGTGAACATTGGCATGATAGACCAGTCCCGGGATGCCTCTGCTGTCAGCCTGTCAGAATCCAAGTCAAGTCAGGATTCCTCTGA
Protein Length	36
Start Codon	AGG
Location	chr1:11228914-11231031:-
Blocks	11228914-11228918,11230924-11231031
Mean PhyloCSF	-8.19363963497
Data Source	Ribosome profiling;
Related Genes	ENSG00000198793; MTOR;
Mass (Da)	mono. 4035; avg. 4037.6

Ribosome profiling

Ribo-seq ID	Ensembl Gene ID	Ensembl Transcript ID	Symbol	Gene Type	TIS Type	Ribo P value	TIS P value	Start On Trans	Stop On Trans	In-frame Count	Ribo-seq RPKM
GSE123564_1_alt	ENSG00000198793.12	ENST00000361445.8	MTOR	Protein_coding	Internal	0.035029	None	2749	2860	6	10.7780176
GSE123564_1	ENSG00000198793.12	ENST00000361445.8	MTOR	Protein_coding	Internal	0.035029	None	2749	2860	6	10.7780176

Min Ribo P value	0.035029
Min TIS P value	None

Ribo-seq ID	Cell or Tissue	Phenotype	Ribo-seq Source Details	PMID
GSE123564_1	Skin fibroblasts	WT	GSM3507221; GSM3507222; GSM3507226; GSM3507227	30707697;
GSE123564_1_alt	Skin fibroblasts	WT	GSM3507221; GSM3507222; GSM3507226; GSM3507227	30707697;

Database information

No results

Literature information

No results

Mass Spectrometry Information

No results

Function and Disease

Functional domain prediction

Analysis	Signature Accession	Signature Description	Start location	Stop location	Score	Status of the match	InterPro accession	InterPro description	GO	Pathways
No results

Disease	Detected
No results

Related Variants

Variant ID	Consequence to sORF	rsID	Ribo-seq ID
No results

Related Small Proteins with Different TISs

SmProt ID	Small Protein Length	Start Codon	Strand	Blocks
No results