SmProt

Specific Information of Small Protein : SPROHSA84370

General Information

Small Protein ID	SPROHSA84370
Organism	Human (Homo sapiens)
Small Protein Sequence	REVHGGRRRHRGRHLCGAVGYSLSIRRYSLGNSFSCYESSYKFQADF*
RNA Sequence	AGGGAAGTTCATGGTGGTCGGCGGCGGCATCGCGGGCGTCACTTGTGCGGAGCAGTTGGCTACTCACTTTCCATCAGAAGATATTCTCTTGGTAACAGCTTCTCCTGTTATGAAAGCAGTTACAAATTTCAAGCAGATTTCTAA
Protein Length	47
Start Codon	AGG
Location	chr11:106827717-106827861:-
Blocks	106827717-106827861
Mean PhyloCSF	0
Data Source	Ribosome profiling;
Related Genes	ENSG00000152402; GUCY1A2; ENSG00000213252; AP001282.1;
Mass (Da)	mono. 5464.7; avg. 5468

Ribosome profiling

Ribo-seq ID	Ensembl Gene ID	Ensembl Transcript ID	Symbol	Gene Type	TIS Type	Ribo P value	TIS P value	Start On Trans	Stop On Trans	In-frame Count	Ribo-seq RPKM
GSE45833_6_alt	ENSG00000213252.3	ENST00000531301.1	AP001282.1	Processed_pseudogene	Novel	0.019094	None	29	173	12	14.2394085

Min Ribo P value	0.019094
Min TIS P value	None

Ribo-seq ID	Cell or Tissue	Phenotype	Ribo-seq Source Details	PMID
GSE45833_6_alt	BJ cells	Transformed	GSM1047591	23594524;

Database information

No results

Literature information

No results

Mass Spectrometry Information

No results

Function and Disease

Functional domain prediction

Analysis	Signature Accession	Signature Description	Start location	Stop location	Score	Status of the match	InterPro accession	InterPro description	GO	Pathways
No results

Disease	Detected
No results

Related Variants

Variant ID	Consequence to sORF	rsID	Ribo-seq ID
11-106827786-T-C	Non-Synonymous p.R26G	.	SRR5239056; SRR5239058; SRR5350740; SRR5350744; SRR5350745; SRR8310198; SRR810101; SRR810102; SRR810104

Related Small Proteins with Different TISs

SmProt ID	Small Protein Length	Start Codon	Strand	Blocks
No results