Specific Information of Small Protein : SPROHSA394412
General Information
Small Protein ID | SPROHSA394412 |
Organism | Human (Homo sapiens) |
Small Protein Sequence | LRRRPSGVRSASDEGPTAGRHQRARLARHWEGPGARSPPRPERMRCALRAG |
RNA Sequence | NA |
Protein Length | 51 |
Start Codon | non-ATG |
Location | chr5:160311949-160312496:- |
Blocks | NA |
Mean PhyloCSF | NA |
Data Source | Literature; |
Related Genes | ENSG00000135083; CCNJL; |
Mass (Da) | mono. 5681; avg. 5684.4 |
Literature information
PMID | 26687005; |
Cell lines Or Tissues | BJ |
Phenotype | NULL |
Gene ID | ENSG00000135083 |
Transcript ID | ENST00000520748 |
Symbol | NA |
ORF Type | sORF |
Gene Type | protein_coding |
Throughput | High-throughput Literature Mining |
Interaction | NA |
Function Description | NA |
Mass Spectrometry Information
Function and Disease
Functional domain prediction |       |
Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
---|
No results |
Disease | Detected |
---|
No results |
Related Variants
Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
---|
No results |
Related Small Proteins with Different TISs
SmProt ID | Small Protein Length | Start Codon | Strand | Blocks |
---|
No results |