Specific Information of Small Protein : SPROHSA394412
General Information
| Small Protein ID | SPROHSA394412 |
| Organism | Human (Homo sapiens) |
| Small Protein Sequence | LRRRPSGVRSASDEGPTAGRHQRARLARHWEGPGARSPPRPERMRCALRAG |
| RNA Sequence | NA |
| Protein Length | 51 |
| Start Codon | non-ATG |
| Location | chr5:160311949-160312496:- |
| Blocks | NA |
| Mean PhyloCSF | NA |
| Data Source | Literature; |
| Related Genes | ENSG00000135083; CCNJL; |
| Mass (Da) | mono. 5681; avg. 5684.4 |
Literature information
| PMID | 26687005; |
| Cell lines Or Tissues | BJ |
| Phenotype | NULL |
| Gene ID | ENSG00000135083 |
| Transcript ID | ENST00000520748 |
| Symbol | NA |
| ORF Type | sORF |
| Gene Type | protein_coding |
| Throughput | High-throughput Literature Mining |
| Interaction | NA |
| Function Description | NA |
Mass Spectrometry Information
Function and Disease
| Functional domain prediction |  |
| Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
|---|
| No results |
| Disease | Detected |
|---|
| No results |
Related Variants
| Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
|---|
| No results |
Related Small Proteins with Different TISs
| SmProt ID | Small Protein Length | Start Codon | Strand | Blocks |
|---|
| No results |
SmProt