Specific Information of Small Protein : SPROHSA295061
General Information
| Small Protein ID | SPROHSA295061 |
| Organism | Human (Homo sapiens) |
| Small Protein Sequence | LACQDPEGAEHAPLGIFGAPSLFAAGVYHPRPSPLPVSVWLGFFRGNRDSQT* |
| RNA Sequence | CTGGCCTGCCAGGACCCAGAGGGAGCGGAGCACGCGCCTTTGGGAATCTTCGGTGCGCCAAGTCTGTTCGCCGCCGGGGTCTATCACCCCCGCCCCTCGCCTCTGCCCGTGAGCGTCTGGCTTGGCTTTTTCAGAGGAAACAGAGACTCTCAGACATGA |
| Protein Length | 52 |
| Start Codon | CTG |
| Location | chr10:95904892-95907893:- |
| Blocks | 95904892-95904935,95907777-95907893 |
| Mean PhyloCSF | -8.34967921515 |
| Data Source | Ribosome profiling; |
| Related Genes | ENSG00000226688; ENTPD1-AS1; ENSG00000188649; CC2D2B; ENSG00000270099; AL365273.2; NONHSAG061460; |
| Mass (Da) | mono. 5531.8; avg. 5535.2 |
Ribosome profiling
| Min Ribo P value | 0.035637 |
| Min TIS P value | None |
| Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
|---|
| GSE123564_2_alt | Skin fibroblasts: Hbs1L-deficient | Facial dysmorphism, growth restriction and retinal deposits | GSM3507223; GSM3507224; GSM3507225; GSM3507228; GSM3507229; GSM3507230 | 30707697; |
Mass Spectrometry Information
Function and Disease
| Functional domain prediction |       |
| Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
|---|
| No results |
| Disease | Detected |
|---|
| No results |
Related Variants
| Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
|---|
| 10-95907825-G-T | Non-Synonymous p.F23L | rs41291578 | SRR1795427; SRR964946; SRR618772; SRR618771; SRR618773 |
Related Small Proteins with Different TISs
| SmProt ID | Small Protein Length | Start Codon | Strand | Blocks |
|---|
| No results |