SmProt

Specific Information of Small Protein : SPROHSA211309

General Information

Small Protein ID	SPROHSA211309
Organism	Human (Homo sapiens)
Small Protein Sequence	MVEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYGPPGTGKTSTILACAKQLYKDKEFG
RNA Sequence	atGGTTGAAAAATACCGGCCACAGACCCTGAATGATCTCATTTCTCATCAGGACATTCTGAGTACCATTCAGAAGTTTATCAATGAAGACCGACTGCCACACTTGCTTCTCTACGGTCCCCCAGGGACAGGCAAGACATCTACCATCCTAGCCTGTGCGAAACAGCTATATAAAGACAAAGAATTTGGC
Protein Length	63
Start Codon	atG
Location	chr12:118018051-118019753:+
Blocks	118018051-118018053,118019071-118019136,118019631-118019753
Mean PhyloCSF	6.81580949673
Data Source	Ribosome profiling;
Related Genes	ENSG00000111445; RFC5; NONHSAG065740;
Mass (Da)	mono. 7184.8; avg. 7189.2

Ribosome profiling

Ribo-seq ID	Ensembl Gene ID	Ensembl Transcript ID	Symbol	Gene Type	TIS Type	Ribo P value	TIS P value	Start On Trans	Stop On Trans	In-frame Count	Ribo-seq RPKM
SRR5512738	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	0.001044	None	384	573	115	77.1345070
SRR4045276	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	0.000277	None	384	573	17	21.3031634
GSE45833_5	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	0.005967	None	384	573	6	12.2359099
GSE45833_5_alt	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	0.005967	None	384	573	6	12.2359099
SRR3317843	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	0.010956	None	384	573	11	48.9794518
SRR3317843_alt	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	0.010956	None	384	573	11	48.9794518
GSE45833_2	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	0.016868	None	384	573	8	5.81251503
SRR3208921	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	0.006274	None	384	573	12	14.1132866
GSE123564_2	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	0.043081	None	384	573	45	34.1322344
GSE123564_2_alt	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	0.043081	None	384	573	45	34.1322344
GSE105082	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	3.116E-09	None	384	573	213	76.5840118
GSE94454	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	2.441E-15	None	384	573	288	67.8334283
SRR5047771	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	0.00401	None	384	573	21	5.08135604
SRR5047770	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	0.040711	None	384	573	17	7.13641958
GSE94613_2	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	0.01406	None	384	573	30	33.0292030
SRR7207252	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	0.00437	None	384	573	46	64.3643799
GSE83493	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	0.001212	None	384	573	78	49.4580935
SRR2991181	ENSG00000111445.14	ENST00000535092.1	RFC5	Protein_coding	Annotated	3.053E-06	None	384	573	105	90.8043225

Min Ribo P value	2.441E-15
Min TIS P value	None

Ribo-seq ID	Cell or Tissue	Phenotype	Ribo-seq Source Details	PMID
GSE105082	HELA	Cervical cancer	GSM2817679; GSM2817680	30591072;
GSE123564_2	Skin fibroblasts: Hbs1L-deficient	Facial dysmorphism, growth restriction and retinal deposits	GSM3507223; GSM3507224; GSM3507225; GSM3507228; GSM3507229; GSM3507230	30707697;
GSE123564_2_alt	Skin fibroblasts: Hbs1L-deficient	Facial dysmorphism, growth restriction and retinal deposits	GSM3507223; GSM3507224; GSM3507225; GSM3507228; GSM3507229; GSM3507230	30707697;
GSE45833_2	BJ cells	Quiescence	GSM1047586; GSM1047587	23594524;
GSE45833_5	BJ cells	Senescence	GSM1047590	23594524;
GSE45833_5_alt	BJ cells	Senescence	GSM1047590	23594524;
GSE83493	HeLa S3	Cervical cancer	GSM2204389; GSM2204390; GSM2204391; GSM2204392	28460002;
GSE94454	Huh7	Hepatoma	GSM2476003; GSM2476004; GSM2476005	28323820;
GSE94613_2	MOLM13	Acute myeloid leukemia	GSM2481053	29186125;
SRR2991181	SH-SY5Y	Neuroblastoma	GSM1970518	31109297;
SRR3208921	ES cell-derived neurons TSC2-/-	Tuberous sclerosis complex	GSM2082573	27655340;
SRR3317843	U2OS cells	WT	GSM2103080	27406171;
SRR3317843_alt	U2OS cells	WT	GSM2103080	27406171;
SRR4045276	Meg01 cells	WT	GSM2285909	27681415;
SRR5047770	iPSC-differentiated dopamine neurons	Parkinson Disease	GSM2402496; GSM2402497; GSM2402498	NA;
SRR5047771	iPSC-differentiated dopamine neurons	Parkinson Disease	NA	NA;
SRR5512738	GM19147-Lymphoblastoid Cell Line	WT	GSM2601312	29950183;
SRR7207252	MCF10A-ER-Src	Breast adenocarcinoma	GSM3150265	30089253;

Database information

No results

Literature information

No results

Mass Spectrometry Information

No results

Function and Disease

Functional domain prediction

Analysis	Signature Accession	Signature Description	Start location	Stop location	Score	Status of the match	InterPro accession	InterPro description
Gene3D	G3DSA:3.40.50.300		1	62	2.7E-21	T
SUPERFAMILY	SSF52540		2	59	5.6E-17	T	IPR027417	P-loop containing nucleoside triphosphate hydrolase
CDD	cd18038	DEXXQc_Helz-like	31	58	2.8599E-9	T
PANTHER	PTHR11669		2	60	4.1E-30	T
Pfam	PF03215	Rad17 P-loop domain	2	56	4.0E-8	T
PANTHER	PTHR11669:SF9		2	60	4.1E-30	T

Disease	Detected
No results

Related Variants

Variant ID	Consequence to sORF	rsID	Ribo-seq ID
12-118019670-C-T	Non-Synonymous p.L36F	.	SRR5239057

Related Small Proteins with Different TISs

SmProt ID	Small Protein Length	Start Codon	Strand	Blocks
No results

a reliable repository with comprehensive annotation of small proteins derived from ribosome profiling