SmProt

Specific Information of Small Protein : SPROHSA161242

General Information

Small Protein ID	SPROHSA161242
Organism	Human (Homo sapiens)
Small Protein Sequence	MQAAKSPLPTGKRVPADSGARQGQNDEAPELARRCGCGCAARRGPSSATRRVVT*
RNA Sequence	ATGCAAGCAGCGAAGTCGCCGCTCCCCACAGGCAAGAGAGTACCGGCAGACAGCGGCGCGAGACAGGGGCAGAACGATGAGGCGCCGGAGTTAGCTCgccggtgcgggtgcgggtgcgcggcgcgtcgcggCCCCTCCTCCGCGACGCGCCGGGTGGTCACGTGA
Protein Length	54
Start Codon	ATG
Location	chr6:127266678-127266843:+
Blocks	127266678-127266843
Mean PhyloCSF	-6.48647275838
Data Source	Ribosome profiling;
Related Genes	ENSG00000118518; RNF146; NONHSAG113352;
Mass (Da)	mono. 5590.8; avg. 5594.3

Ribosome profiling

Ribo-seq ID	Ensembl Gene ID	Ensembl Transcript ID	Symbol	Gene Type	TIS Type	Ribo P value	TIS P value	Start On Trans	Stop On Trans	In-frame Count	Ribo-seq RPKM
GSE45833_6	ENSG00000118518.15	ENST00000368314.5	RNF146	Protein_coding	5'UTR	0.035688	None	69	234	5	5.17796674
GSE45833_6_alt	ENSG00000118518.15	ENST00000368314.5	RNF146	Protein_coding	5'UTR	0.035688	None	69	234	5	5.17796674

Min Ribo P value	0.035688
Min TIS P value	None

Ribo-seq ID	Cell or Tissue	Phenotype	Ribo-seq Source Details	PMID
GSE45833_6	BJ cells	Transformed	GSM1047591	23594524;
GSE45833_6_alt	BJ cells	Transformed	GSM1047591	23594524;

Database information

No results

Literature information

No results

Mass Spectrometry Information

No results

Function and Disease

Functional domain prediction

Analysis	Signature Accession	Signature Description	Start location	Stop location	Score	Status of the match	InterPro accession	InterPro description	GO	Pathways
No results

Disease	Detected
No results

Related Variants

Variant ID	Consequence to sORF	rsID	Ribo-seq ID
No results

Related Small Proteins with Different TISs

SmProt ID	Small Protein Length	Start Codon	Strand	Blocks
No results