Small Protein ID | SPROHSA148481 | ||
Organism | human (Homo sapiens) | ||
Small Protein Sequence | MTHVRAKTWGRRRVVESGSIVGGERNIQDLKQLL* | ||
RNA Sequence | ATGACGCACGTGCGCGCGAAGACGTGGGGACGCAGGCGGGTCGTAGAGAGCGGGTCCATTGTAGGGGGAGAAAGAAATATTCAGGATTTAAAGCAGCTGCTCTAA | ||
Protein Length | 34 | ||
Start Codon | ATG | ||
Location | chr2:226836036-226838126:+ | ||
Blocks | 226836036-226836087,226838072-226838126 | ||
Mean PhyloCSF | -7.9186000824 | ||
Data Source | Ribosome profiling; | ||
Related Genes | ENSG00000144468; RHBDD1; |
RiboID | GeneID | TransID | Symbol | GeneType | TISType | RiboPvalue | TISPvalue | StartOnTrans | StopOnTrans |
---|---|---|---|---|---|---|---|---|---|
GSE94613_2 | ENSG00000144468.17 | ENST00000437454.5 | RHBDD1 | protein_coding | 5'UTR | 0.004574 | None | 3 | 108 |
Min Ribo Pvalue | 0.004574 |
Min TIS Pvalue | None |
RiboID | CellORTissue | Phenotype | RiboSource | PMID |
---|---|---|---|---|
GSE94613_2 | MOLM13 | acute myeloid leukemia | GSM2481053 | 29186125; |
No results |
No results |
No results |
Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
---|---|---|---|---|---|---|---|---|---|---|
Coils | Coil | 20 | 34 | - | T |
Disease | Detected |
---|---|
acute myeloid leukemia | PredictedByRibo |
VarID | Consequence To sORF | rsID | RiboID |
---|---|---|---|
No results |
ID | Small Protein Length | Start Codon | Strand | Blocks |
---|---|---|---|---|
SPROHSA48157 | 33 | ACG | + | 226836039-226836087,226838072-226838126 |
PMID | 29186125 |
Title | Promoter-bound METTL3 maintains myeloid leukaemia by m 6 A-dependent translation control |
Journal | Nature.2017 Dec 7;552(7683):126-131.doi: 10.1038/nature24678.Epub 2017 Nov 27. |
Authors | Isaia Barbieri,Konstantinos Tzelepis,Luca Pandolfini,Junwei Shi,Gonzalo Millán-Zambrano,Samuel C Robson,Demetrios Aspris,Valentina Migliori,Andrew J Bannister,Namshik Han,Etienne De Braekeleer,Hannes Ponstingl,Alan Hendrick,Christopher R Vakoc,George S Vassiliou,Tony Kouzarides |