Specific Information of Small Protein : SPROHSA148481
General Information
| Small Protein ID | SPROHSA148481 | ||
| Organism | human (Homo sapiens) | ||
| Small Protein Sequence | MTHVRAKTWGRRRVVESGSIVGGERNIQDLKQLL* | ||
| RNA Sequence | ATGACGCACGTGCGCGCGAAGACGTGGGGACGCAGGCGGGTCGTAGAGAGCGGGTCCATTGTAGGGGGAGAAAGAAATATTCAGGATTTAAAGCAGCTGCTCTAA | ||
| Protein Length | 34 | ||
| Start Codon | ATG | ||
| Location | chr2:226836036-226838126:+ | ||
| Blocks | 226836036-226836087,226838072-226838126 | ||
| Mean PhyloCSF | -7.9186000824 | ||
| Data Source | Ribosome profiling; | ||
| Related Genes | ENSG00000144468; RHBDD1; | ||
Ribosome profiling
| RiboID | GeneID | TransID | Symbol | GeneType | TISType | RiboPvalue | TISPvalue | StartOnTrans | StopOnTrans |
|---|---|---|---|---|---|---|---|---|---|
| GSE94613_2 | ENSG00000144468.17 | ENST00000437454.5 | RHBDD1 | protein_coding | 5'UTR | 0.004574 | None | 3 | 108 |
| Min Ribo Pvalue | 0.004574 |
| Min TIS Pvalue | None |
| RiboID | CellORTissue | Phenotype | RiboSource | PMID |
|---|---|---|---|---|
| GSE94613_2 | MOLM13 | acute myeloid leukemia | GSM2481053 | 29186125; |
Database information
| No results |
Literature information
| No results |
Mass Spectrometry Information
| No results |
Function and Disease
| Functional domain prediction |  |
| Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
|---|---|---|---|---|---|---|---|---|---|---|
| Coils | Coil | 20 | 34 | - | T |
| Disease | Detected |
|---|---|
| acute myeloid leukemia | PredictedByRibo |
Related Variants
| VarID | Consequence To sORF | rsID | RiboID |
|---|---|---|---|
| No results | |||
Related Small Proteins with Different TISs
| ID | Small Protein Length | Start Codon | Strand | Blocks |
|---|---|---|---|---|
| SPROHSA48157 | 33 | ACG | + | 226836039-226836087,226838072-226838126 |
References
| PMID | 29186125 |
| Title | Promoter-bound METTL3 maintains myeloid leukaemia by m 6 A-dependent translation control |
| Journal | Nature.2017 Dec 7;552(7683):126-131.doi: 10.1038/nature24678.Epub 2017 Nov 27. |
| Authors | Isaia Barbieri,Konstantinos Tzelepis,Luca Pandolfini,Junwei Shi,Gonzalo Millán-Zambrano,Samuel C Robson,Demetrios Aspris,Valentina Migliori,Andrew J Bannister,Namshik Han,Etienne De Braekeleer,Hannes Ponstingl,Alan Hendrick,Christopher R Vakoc,George S Vassiliou,Tony Kouzarides |