Specific Information of Small Protein : SPROHSA148481
General Information
Small Protein ID | SPROHSA148481 |
Organism | Human (Homo sapiens) |
Small Protein Sequence | MTHVRAKTWGRRRVVESGSIVGGERNIQDLKQLL* |
RNA Sequence | ATGACGCACGTGCGCGCGAAGACGTGGGGACGCAGGCGGGTCGTAGAGAGCGGGTCCATTGTAGGGGGAGAAAGAAATATTCAGGATTTAAAGCAGCTGCTCTAA |
Protein Length | 34 |
Start Codon | ATG |
Location | chr2:226836036-226838126:+ |
Blocks | 226836036-226836087,226838072-226838126 |
Mean PhyloCSF | -7.9186000824 |
Data Source | Ribosome profiling; |
Related Genes | ENSG00000144468; RHBDD1; |
Mass (Da) | mono. 3889.1; avg. 3891.5 |
Ribosome profiling
Min Ribo P value | 0.004574 |
Min TIS P value | None |
Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
---|
GSE94613_2 | MOLM13 | Acute myeloid leukemia | GSM2481053 | 29186125; |
Mass Spectrometry Information
Function and Disease
Functional domain prediction |      |
Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
---|
Coils | Coil | | 20 | 34 | - | T | | | | |
Disease | Detected |
---|
Acute myeloid leukemia | Predicted by Ribo-seq |
Related Variants
Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
---|
No results |
Related Small Proteins with Different TISs
SmProt ID | Small Protein Length | Start Codon | Strand | Blocks |
---|
SPROHSA48157 | 33 | ACG | + | 226836039-226836087, 226838072-226838126 |