Small Protein ID | SPROHSA145930 | ||
Organism | human (Homo sapiens) | ||
Small Protein Sequence | MTDSSARTEALSILYPAVRYWRRKTFNKYLLNDEYALGVAK* | ||
RNA Sequence | ATGACAGACagctctgcaagaacggaggccctgtctattttgtacccagctgtacggtactggcgccgaaagacgttcaataaatacttattgaatgacgaatACGCGTTAGGAGTTGCAAAATAA | ||
Protein Length | 41 | ||
Start Codon | ATG | ||
Location | chr2:174396175-174397343:+ | ||
Blocks | 174396175-174396293,174397335-174397343 | ||
Mean PhyloCSF | -7.10054760509 | ||
Data Source | Ribosome profiling; | ||
Related Genes | ENSG00000144306; SCRN3; NONHSAG077962; |
RiboID | GeneID | TransID | Symbol | GeneType | TISType | RiboPvalue | TISPvalue | StartOnTrans | StopOnTrans |
---|---|---|---|---|---|---|---|---|---|
SRR5047772 | ENSG00000144306.14 | ENST00000488349.1 | SCRN3 | protein_coding | Novel | 0.035269 | None | 381 | 507 |
GSE94613_2 | ENSG00000144306.14 | ENST00000488349.1 | SCRN3 | protein_coding | Novel | 0.003483 | None | 381 | 507 |
GSE94613_2_alt | ENSG00000144306.14 | ENST00000488349.1 | SCRN3 | protein_coding | Novel | 0.003483 | None | 381 | 507 |
Min Ribo Pvalue | 0.003483 |
Min TIS Pvalue | None |
No results |
No results |
No results |
Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
---|---|---|---|---|---|---|---|---|---|---|
No results |
Disease | Detected |
---|---|
acute myeloid leukemia | PredictedByRibo |
VarID | Consequence To sORF | rsID | RiboID |
---|---|---|---|
2-174396181-A-T | Synonymous p.T2T | rs79355383 | SRR5239057;SRR5239058 |
ID | Small Protein Length | Start Codon | Strand | Blocks |
---|---|---|---|---|
No results |
PMID | 29186125 |
Title | Promoter-bound METTL3 maintains myeloid leukaemia by m 6 A-dependent translation control |
Journal | Nature.2017 Dec 7;552(7683):126-131.doi: 10.1038/nature24678.Epub 2017 Nov 27. |
Authors | Isaia Barbieri,Konstantinos Tzelepis,Luca Pandolfini,Junwei Shi,Gonzalo Millán-Zambrano,Samuel C Robson,Demetrios Aspris,Valentina Migliori,Andrew J Bannister,Namshik Han,Etienne De Braekeleer,Hannes Ponstingl,Alan Hendrick,Christopher R Vakoc,George S Vassiliou,Tony Kouzarides |