Specific Information of Small Protein : SPROHSA145930
General Information
| Small Protein ID | SPROHSA145930 |
| Organism | Human (Homo sapiens) |
| Small Protein Sequence | MTDSSARTEALSILYPAVRYWRRKTFNKYLLNDEYALGVAK* |
| RNA Sequence | ATGACAGACagctctgcaagaacggaggccctgtctattttgtacccagctgtacggtactggcgccgaaagacgttcaataaatacttattgaatgacgaatACGCGTTAGGAGTTGCAAAATAA |
| Protein Length | 41 |
| Start Codon | ATG |
| Location | chr2:174396175-174397343:+ |
| Blocks | 174396175-174396293,174397335-174397343 |
| Mean PhyloCSF | -7.10054760509 |
| Data Source | Ribosome profiling; |
| Related Genes | ENSG00000144306; SCRN3; NONHSAG077962; |
| Mass (Da) | mono. 4809.5; avg. 4812.5 |
Ribosome profiling
| Ribo-seq ID | Ensembl Gene ID | Ensembl Transcript ID | Symbol | Gene Type | TIS Type | Ribo P value | TIS P value | Start On Trans | Stop On Trans | In-frame Count | Ribo-seq RPKM |
|---|
| SRR5047772 | ENSG00000144306.14 | ENST00000488349.1 | SCRN3 | Protein_coding | Novel | 0.035269 | None | 381 | 507 | 3 | 4.21006762 |
| GSE94613_2 | ENSG00000144306.14 | ENST00000488349.1 | SCRN3 | Protein_coding | Novel | 0.003483 | None | 381 | 507 | 7 | 11.5602210 |
| GSE94613_2_alt | ENSG00000144306.14 | ENST00000488349.1 | SCRN3 | Protein_coding | Novel | 0.003483 | None | 381 | 507 | 7 | 11.5602210 |
| Min Ribo P value | 0.003483 |
| Min TIS P value | None |
| Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
|---|
| GSE94613_2 | MOLM13 | Acute myeloid leukemia | GSM2481053 | 29186125; |
| GSE94613_2_alt | MOLM13 | Acute myeloid leukemia | GSM2481053 | 29186125; |
| SRR5047772 | iPSC-differentiated dopamine neurons | Parkinson Disease | NA | NA; |
Mass Spectrometry Information
Function and Disease
| Functional domain prediction |  |
| Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
|---|
| No results |
| Disease | Detected |
|---|
| Acute myeloid leukemia | Predicted by Ribo-seq |
Related Variants
| Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
|---|
| 2-174396181-A-T | Synonymous p.T2T | rs79355383 | SRR5239057; SRR5239058 |
Related Small Proteins with Different TISs
| SmProt ID | Small Protein Length | Start Codon | Strand | Blocks |
|---|
| No results |
SmProt