Specific Information of Small Protein : SPROHSA142601
General Information
| Small Protein ID | SPROHSA142601 | ||
| Organism | human (Homo sapiens) | ||
| Small Protein Sequence | MKAVSGMKSDSSSFTTSSGALPALLPSIASSSVLPEF* | ||
| RNA Sequence | ATGAAGGCCGTTTCTGGAATGAAGTCTGACTCCTCCAGTTTCACCACCTCTTCCGGAGCTCTCCCCGCCTTGCTGCCTTCCATCGCTTCATCCTCGGTGCTTCCTGAGTTTTAA | ||
| Protein Length | 37 | ||
| Start Codon | ATG | ||
| Location | chr8:11803331-11803445:+ | ||
| Blocks | 11803331-11803445 | ||
| Mean PhyloCSF | -7.23371062153 | ||
| Data Source | Ribosome profiling; | ||
| Related Genes | ENSG00000079459; FDFT1; | ||
Ribosome profiling
| RiboID | GeneID | TransID | Symbol | GeneType | TISType | RiboPvalue | TISPvalue | StartOnTrans | StopOnTrans |
|---|---|---|---|---|---|---|---|---|---|
| GSE94613_2 | ENSG00000079459.13 | ENST00000525551.1 | FDFT1 | protein_coding | Novel | 0.003419 | None | 158 | 272 |
| GSE94613_2 | ENSG00000079459.13 | ENST00000527045.1 | FDFT1 | protein_coding | Novel | 0.003419 | None | 158 | 272 |
| GSE94613_2 | ENSG00000079459.13 | ENST00000525607.5 | FDFT1 | protein_coding | Internal | 0.003419 | None | 201 | 315 |
| GSE94613_2 | ENSG00000079459.13 | ENST00000525571.1 | FDFT1 | protein_coding | Novel | 0.003419 | None | 309 | 423 |
| GSE94613_2 | ENSG00000079459.13 | ENST00000528812.5 | FDFT1 | protein_coding | 5'UTR | 0.003419 | None | 320 | 434 |
| GSE94613_2 | ENSG00000079459.13 | ENST00000623368.3 | FDFT1 | protein_coding | 5'UTR | 0.003419 | None | 331 | 445 |
| Min Ribo Pvalue | 0.003419 |
| Min TIS Pvalue | None |
| RiboID | CellORTissue | Phenotype | RiboSource | PMID |
|---|---|---|---|---|
| GSE94613_2 | MOLM13 | acute myeloid leukemia | GSM2481053 | 29186125; |
Database information
| No results |
Literature information
| No results |
Mass Spectrometry Information
| No results |
Function and Disease
| Functional domain prediction |  |
| Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
|---|---|---|---|---|---|---|---|---|---|---|
| No results | ||||||||||
| Disease | Detected |
|---|---|
| acute myeloid leukemia | PredictedByRibo |
Related Variants
| VarID | Consequence To sORF | rsID | RiboID |
|---|---|---|---|
| 8-11803407-C-T | Non-Synonymous p.P26S | rs2252567 | SRR5239051;SRR5239052 |
Related Small Proteins with Different TISs
| ID | Small Protein Length | Start Codon | Strand | Blocks |
|---|---|---|---|---|
| SPROHSA32325 | 36 | AAG | + | 11803334-11803445 |
References
| PMID | 29186125 |
| Title | Promoter-bound METTL3 maintains myeloid leukaemia by m 6 A-dependent translation control |
| Journal | Nature.2017 Dec 7;552(7683):126-131.doi: 10.1038/nature24678.Epub 2017 Nov 27. |
| Authors | Isaia Barbieri,Konstantinos Tzelepis,Luca Pandolfini,Junwei Shi,Gonzalo Millán-Zambrano,Samuel C Robson,Demetrios Aspris,Valentina Migliori,Andrew J Bannister,Namshik Han,Etienne De Braekeleer,Hannes Ponstingl,Alan Hendrick,Christopher R Vakoc,George S Vassiliou,Tony Kouzarides |