Specific Information of Small Protein : SPROHSA141390
General Information
Small Protein ID | SPROHSA141390 |
Organism | Human (Homo sapiens) |
Small Protein Sequence | MKQHARPGTSPAPASGLEGQGRGPGGRRGLWSSPSARVVARNGDRARARSLLPAPPRPRVFLPRDSERPLLQARLAAGR* |
RNA Sequence | ATGAAGCAACATGCTAGGCCCGGGACAAGTCCGGCTCCGGCCTCGGGTCTGGAGGGACAAGGCCGGGGGCCGGGTGGCAGACGGGGCCTCTGGTCTTCCCCCAGCGCGAGGGTCGTGGCGCGAAACGGGGACAGGGCGCGCGCTCGGAGCCTCCTCCCCGCCCCGCCCCGCCCAAGGGTCTTCCTCCCCCGGGATTCAGAGCGGCCCCTCCTCCAGGCCAGGCTCGCCGCGGGGCGCTGA |
Protein Length | 79 |
Start Codon | ATG |
Location | chr1:244970112-244970352:+ |
Blocks | 244970112-244970352 |
Mean PhyloCSF | -5.51705959544 |
Data Source | Ribosome profiling; |
Related Genes | ENSG00000203666; EFCAB2; ENSG00000272195; AL356512.1; NONHSAG105240;NONHSAG004873; |
Mass (Da) | mono. 8406.6; avg. 8411.5 |
Ribosome profiling
Ribo-seq ID | Ensembl Gene ID | Ensembl Transcript ID | Symbol | Gene Type | TIS Type | Ribo P value | TIS P value | Start On Trans | Stop On Trans | In-frame Count | Ribo-seq RPKM |
---|
GSE94613_2 | ENSG00000203666.12 | ENST00000366522.6 | EFCAB2 | Protein_coding | 5'UTR | 0.007116 | None | 131 | 371 | 15 | 13.0052487 |
GSE94613_2_alt | ENSG00000203666.12 | ENST00000366522.6 | EFCAB2 | Protein_coding | 5'UTR | 0.007116 | None | 131 | 371 | 15 | 13.0052487 |
Min Ribo P value | 0.007116 |
Min TIS P value | None |
Ribo-seq ID | Cell or Tissue | Phenotype | Ribo-seq Source Details | PMID |
---|
GSE94613_2 | MOLM13 | Acute myeloid leukemia | GSM2481053 | 29186125; |
GSE94613_2_alt | MOLM13 | Acute myeloid leukemia | GSM2481053 | 29186125; |
Mass Spectrometry Information
Function and Disease
Functional domain prediction |      |
Analysis | Signature Accession | Signature Description | Start location | Stop location | Score | Status of the match | InterPro accession | InterPro description | GO | Pathways |
---|
MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 67 | - | T | | | | |
Disease | Detected |
---|
Acute myeloid leukemia | Predicted by Ribo-seq |
Related Variants
Variant ID | Consequence to sORF | rsID | Ribo-seq ID |
---|
No results |
Related Small Proteins with Different TISs
SmProt ID | Small Protein Length | Start Codon | Strand | Blocks |
---|
No results |